KEGG   Miniopterus natalensis: 107544835
Entry
107544835         CDS       T05883                                 

Definition
(RefSeq) granzyme B-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
mna  Miniopterus natalensis
Pathway
mna04210  Apoptosis
mna04650  Natural killer cell mediated cytotoxicity
mna04940  Type I diabetes mellitus
mna05202  Transcriptional misregulation in cancer
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107544835
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107544835
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107544835
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107544835
   05330 Allograft rejection
    107544835
   05332 Graft-versus-host disease
    107544835
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107544835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107544835
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     107544835
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107544835
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Pico_P2A Peptidase_S29
Other DBs
NCBI-GeneID: 107544835
NCBI-ProteinID: XP_016078245
LinkDB
Position
Unknown
AA seq 259 aa
MQPPLLLLLLAFFLLLGTEAGEIIGGHETKPHSRPYMAYLHIKNEKESRCGGVLVRRNFV
LTAAHCNGRSISVTLGAHNLKKKEKTQQVILVKRTIPHPDYNPRNFSNDIMLLQLERNIK
ETNTVRPLHLPSSKDWPRPGQKCTVAGWGLVAPMGTYPDTLQEVELTVQEDWECQCRLQR
YYNNNTQLCLGNPTEKKASFQGDSGGPLLCENGIQGIVSYGRSDGSAPRVFTKVSSFLPW
IKKIIKNTQLQEPDSLPWS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgcagccacccctgctcctgctcctgctagcctttttcctactcctcgggacagaagca
ggggagatcatcgggggacatgaaaccaagccccactctcgcccctacatggcctacctt
cacattaaaaatgagaaggagtccaggtgtggcggtgtccttgtgagaaggaactttgtc
ctgacagctgctcactgcaatggaaggtcaatcagtgtcaccctgggggcccacaacctc
aaaaagaaggagaagacccagcaggtcatcctagtgaaaagaaccatcccccacccagac
tataatcctaggaacttctccaatgacatcatgttactgcagctggagagaaacatcaag
gaaactaacaccgtgaggcccctccacctgcccagcagcaaggactggccaaggccggga
cagaagtgcactgtggctggctgggggctggttgcccccatgggcacatacccagacact
ctgcaggaagtagagttgactgtgcaggaggattgggaatgccaatgtcgcttacagcgt
tattacaacaacaacactcagctgtgcctggggaacccgacagaaaagaaggcttccttt
cagggggactccgggggacctctcctgtgtgaaaatgggatccagggcattgtctcctat
ggacgctctgatggatcagcaccacgggtcttcaccaaagtctcaagcttcctgccctgg
ataaagaaaatcataaaaaacacccaactgcaggaaccagactctcttccttggagctaa

KEGG   Miniopterus natalensis: 107544836
Entry
107544836         CDS       T05883                                 

Definition
(RefSeq) granzyme H-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
mna  Miniopterus natalensis
Pathway
mna04210  Apoptosis
mna04650  Natural killer cell mediated cytotoxicity
mna04940  Type I diabetes mellitus
mna05202  Transcriptional misregulation in cancer
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107544836
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107544836
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107544836
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107544836
   05330 Allograft rejection
    107544836
   05332 Graft-versus-host disease
    107544836
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107544836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107544836
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     107544836
Peptidases and inhibitors [BR:mna01002]
 Serine peptidases
  Family S1: chymotrypsin family
   107544836
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 107544836
NCBI-ProteinID: XP_016078246
LinkDB
Position
Unknown
AA seq 244 aa
MQPLLLLMAFILASKAQAGTIIGGHEVKPHSRPYMAYLHRITTSGRKTCGGFLVRKDFVL
TAAHCSGSSITVTLGAHDVGQHEGTQQVIPVKKIIPHPNYHPKFNDIMLLKLQRKAKLTA
AVSLLRLPRREEQVNPGMVCSVAGWGRLDLYTTTARLHEVELEIQRNEQCISLYRSHYNT
TTQICVGNPEKKQSTFLGDSGGPLVCDNTAQGIVAFGKKNGKLPRVETRISSFLPWIKRT
MRRF
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcagccacttctgcttctgatggccttcattctggcctccaaggcacaggcagggaca
atcatcggggggcatgaggtcaagcctcactctcgtccctacatggcatatcttcatcgg
atcacaacttcaggcagaaaaacctgtgggggtttccttgtgcgtaaggactttgtgctg
acagctgctcactgttctggaagctccatcacagtaaccctaggagcccacgacgtcggg
cagcacgaggggacccagcaggtcataccggtgaaaaaaatcatcccccacccaaactac
catcccaagttcaatgacatcatgttactgaagctgcagaggaaggccaaactgactgca
gccgtgagcctcctcaggctgcccaggagagaagagcaggtgaacccagggatggtgtgc
agtgtggccggctggggacgtcttgacctgtacaccaccacagccagattgcatgaggta
gagctggaaatccaaaggaacgagcagtgtatttctctctacagaagtcattacaacaca
accacacagatctgtgtggggaacccagaaaaaaaacagtctacttttctgggtgactct
ggaggccccctggtgtgtgacaacacagcccagggcattgttgcctttgggaaaaagaat
ggaaaacttccacgtgttgaaaccaggatctccagctttctgccctggataaaaagaaca
atgaggcgtttctga

DBGET integrated database retrieval system