KEGG   Miniopterus natalensis (Natal long-fingered bat): 107544988
Entry
107544988         CDS       T05883                                 
Symbol
VCP
Name
(RefSeq) transitional endoplasmic reticulum ATPase
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107544988 (VCP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107544988 (VCP)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107544988 (VCP)
   05022 Pathways of neurodegeneration - multiple diseases
    107544988 (VCP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107544988 (VCP)
   03009 Ribosome biogenesis [BR:mna03009]
    107544988 (VCP)
   04131 Membrane trafficking [BR:mna04131]
    107544988 (VCP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544988 (VCP)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     107544988 (VCP)
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    107544988 (VCP)
Membrane trafficking [BR:mna04131]
 SNARE
  SNARE associated proteins
   Others
    107544988 (VCP)
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107544988 (VCP)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107544988 (VCP)
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N CDC48_2 AAA_16 AAA_33 AAA_2 AAA_5 AAA_22 TIP49 Vps4_C AAA_18 RNA_helicase AAA_14 Mg_chelatase IstB_IS21 AAA_28 Parvo_NS1 AAA_7 ATPase ATPase_2 Bac_DnaA ABC_tran DUF815 AAA_17 AAA_24 TsaE Viral_helicase1 Sigma54_activat NACHT Zeta_toxin NB-ARC DUF2075 ResIII bpMoxR UFD1 DUF3944
Other DBs
NCBI-GeneID: 107544988
NCBI-ProteinID: XP_016078481
LinkDB
Position
Unknown
AA seq 806 aa
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRDRERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcctccggagctgattcaaaaggtgatgacttatcaacagccattcttaaacagaag
aatcgtcctaatcggttaattgtcgatgaagccatcaatgaggacaatagtgtggtctcc
ttgtcccagcccaagatggatgagctgcagttgttccgaggtgatacagtgttgctgaaa
ggaaagaagaggcgggaagctgtgtgcattgtgctttctgatgacacatgttctgatgag
aagattcgaatgaatagagttgttcggaataaccttcgcgtacgcctaggggatgtcatc
agcatccagccatgccctgatgtgaagtatggcaaacgcatccacgtgctacccattgat
gacacggtggaaggtatcactggcaatctctttgaggtataccttaagccatacttcctg
gaagcttatcgacccatccggaaaggagacattttccttgtccggggtggaatgcgtgct
gtggagttcaaagtagtggagacagatcccagtccttactgcattgttgctccagacaca
gtgatccactgtgaaggggaacctatcaaacgagaggatgaagaagagtccttgaatgaa
gtaggctatgatgacattggtggctgcaggaaacagctagctcagataaaggagatggtg
gagctgcccctgagacatcctgccctatttaaggcaattggtgtgaagcctcctcgggga
attctgctctatggacctcctgggactgggaagaccctgattgctcgagctgtggcaaat
gagacaggggccttcttcttcttgatcaatggtcctgagatcatgagcaagttggctggt
gagtctgagagcaaccttcgtaaagccttcgaagaggctgagaagaatgctcctgctatc
atcttcattgatgagctggatgccattgctcctaaaagagaaaaaacccatggggaggtg
gaacggcgtattgtatcacagttgttgacccttatggatggcctaaagcagagagcacat
gtgattgtcatggcagcaaccaacagacccaacagcattgacccagccctacgtcgattt
ggtcgctttgacagggaggtagatattggaatccctgatgctacaggacgcttggaaatt
cttcagatccataccaagaacatgaagctggcagatgatgtggacctggaacaggtagcc
aatgagactcatgggcatgtgggtgctgacctagcagccttgtgctcagaggctgctctg
caagccatccgcaagaagatggacctcattgacctagaggatgaaaccattgatgctgag
gtcatgaattccctggcagttactatggatgacttccggtgggccctaagccagagcaac
ccgtcagcattgcgggaaactgtggtggaagtgccacaggtaacctgggaggacattggg
ggcctagaggatgtcaaacgtgagcttcaggaactggtccagtatcctgtggagcaccca
gacaaattcctcaagtttggcatgacaccctctaagggagtactgttctatggacctcct
ggttgtgggaaaaccttgctggccaaagccattgctaatgaatgccaggctaacttcatc
tccatcaaaggtcctgaactgctcaccatgtggtttggggagtctgaggctaatgtcaga
gaaatctttgacaaggcccgccaagctgccccctgtgtactgttctttgatgagctggat
tcaattgccaaggcccgtggtggtaacattggagatggtggtggggctgctgaccgagtt
atcaatcagattctgacagaaatggatggcatgtccacaaaaaagaatgtttttatcatt
ggcgctaccaaccggcctgacatcattgatcctgccatcctgcgacctggccgccttgat
cagctcatctatatcccgcttcctgatgagaagtcccgtgttgccatcctcaaggccaac
ctgcgcaagtccccagttgccaaggatgtggatttggagttcctggctaagatgactaat
ggcttttctggagctgacctgacagagatttgccaacgtgcctgtaagctggccattcgc
gaatccatcgagagtgagattaggcgagaccgtgagaggcagaccaacccatcagccatg
gaggtagaagaagatgatccagtgcccgagatccgccgagatcactttgaggaagccatg
cgctttgcccgccgttctgtcagtgacaatgacattcgaaaatacgagatgttcgctcag
acccttcagcagagtcggggctttggcagtttcagattcccttcaggaaaccagggtgga
gctggccccagtcagggcagtggaggcggcacaggtggcagtgtatacacagaagacaat
gatgacgacctgtatggctaa

DBGET integrated database retrieval system