KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545155
Entry
107545155         CDS       T05883                                 
Symbol
HSP90B1
Name
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04657  IL-17 signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna05132  Salmonella infection
mna05200  Pathways in cancer
mna05207  Chemical carcinogenesis - receptor activation
mna05215  Prostate cancer
mna05417  Lipid and atherosclerosis
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545155 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107545155 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107545155 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107545155 (HSP90B1)
   04918 Thyroid hormone synthesis
    107545155 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545155 (HSP90B1)
   05207 Chemical carcinogenesis - receptor activation
    107545155 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107545155 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545155 (HSP90B1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107545155 (HSP90B1)
   05418 Fluid shear stress and atherosclerosis
    107545155 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107545155 (HSP90B1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP90
   107545155 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 107545155
NCBI-ProteinID: XP_016078712
LinkDB
Position
Unknown
AA seq 800 aa
MRALWVLGLCCLLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEAAKE
EKEESDDEAAVEEEDEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKS
FSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD
FHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYN
DTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSSDITSLDQYVERMKEKQDKIYFM
AGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDES
EKTKENREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERI
MKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFETA
TLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTAEDTEQDEDED
MDAGTDEEETEKSTVEKDEL
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcctactgctgaccttcgggtcagtccga
gctgatgatgaagtcgatgtggatggcacggtagaagaggacctgggtaaaagtagagaa
ggctcaaggacagatgatgaagtagtacagagagaagaagaagctattcagttggatgga
ttaaatgcatcccaaataagagaacttcgagagaaatcagaaaagtttgcctttcaagca
gaagtaaacagaatgatgaaacttatcatcaattcattgtataaaaataaggagattttc
ctgagagaactgatttcaaatgcttctgacgctttagataagataaggctgatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgacaag
gagaagaacctgctacatgtcacagacactggtgtaggaatgaccagggaagagttggtt
aaaaaccttggtaccattgccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaagaagatggccagtcaacttctgaattgattggccagtttggtgttggtttctat
tctgccttccttgtagcagataaggttattgtcacatcaaaacacaacaacgatacccag
cacatctgggaatctgactccaatgaattttctgtaattgctgatccaagaggaaacact
ctaggacgaggaacgacaattacccttgttttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaagtactcacagttcataaactttccaatttat
gtatggagcagcaagactgaaactgttgaggaacccatggaagaagaagccgcaaaagaa
gaaaaggaagaatctgatgatgaggctgcagtagaagaagaagacgaagaaaagaaacca
aaaactaaaaaagttgagaagacggtgtgggactgggaacttatgaatgatatcaaaccg
atatggcagagaccatcgaaagaagtagaggaggatgagtataaagctttctacaagtcg
ttttccaaggaaagcgatgaccccatggcttatatccactttactgctgaaggggaagtt
acctttaagtcaattttatttgtacctacatctgctccacgtggtctgtttgatgaatat
ggatctaagaagagcgattacattaagctctatgtacgccgagtgttcatcacagatgac
ttccatgatatgatgcccaaataccttaattttgtcaagggtgttgtggactcagatgat
ctccccttgaatgtttcccgtgagactcttcagcaacataaactacttaaggtgattaga
aagaagcttgttcgtaaaactctggacatgatcaaaaagattgctgatgagaaatacaat
gatactttctggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccactca
aatcgaacacgtcttgctaaactcctcaggttccagtcttctcatcattcaagtgacatt
actagtctagaccagtatgtggaaagaatgaaggagaaacaagacaaaatctacttcatg
gctgggtccagcagaaaagaggccgaatcttctccatttgttgagcgacttctgaaaaag
gggtatgaagttatttatctcacagaacctgtggatgaatactgcatccaggctcttcct
gagtttgatgggaagaggttccagaacgttgccaaggaaggagtgaagtttgatgaaagt
gagaaaactaaggagaatcgtgaagcaattgagaaagaatttgagcctctgctcaactgg
atgaaagataaagccctcaaggacaagattgaaaaggctgtggtatctcagcgcctgaca
gagtctccgtgtgcccttgtggccagccagtacggatggtctggcaacatggagagaatc
atgaaagctcaagcctaccaaacaggcaaggacatctctacaaattactatgccagccag
aagaaaacatttgaaatcaatcccagacatccgctgatcaaagacatgcttcgacgagtc
aaggaagacgaagatgacaaaacagtttcggatcttgccgtggttttgtttgaaacagca
acactgaggtcaggatatcttttaccagacactaaagcatatggagatagaatagaaaga
atgcttcgcctcagtttaaacattgaccctgatgcaaaggttgaagaagaacctgaagaa
gaacctgaagaaacaacagaggacactgcagaagacacagagcaagacgaagacgaagac
atggacgccggaacagacgaagaagaaacagagaagtctacagttgaaaaagatgaattg
taa

DBGET integrated database retrieval system