KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545165
Entry
107545165         CDS       T05883                                 
Symbol
CKAP4
Name
(RefSeq) cytoskeleton-associated protein 4
  KO
K13999  cytoskeleton-associated protein 4
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545165 (CKAP4)
SSDB
Motif
Pfam: CATRA-C Fez1 Baculo_PEP_C DUF3584 Fib_alpha Cytochrom_C_2 OmpH T2SSF DUF1216 TMPIT
Other DBs
NCBI-GeneID: 107545165
NCBI-ProteinID: XP_016078724
LinkDB
Position
Unknown
AA seq 411 aa
MKQGESEINRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLMELTKSIN
DNIAIFTEVQKRSQKEINDVKAKVTSLEDSEGYKQDLKALKEVVKEIQTSLKSKEKDMEA
LKSSLQTMESDVYTEVKELVSLKQEQQRFKEAADSEHLTLQALSEKILRSEEATSRLPDE
LSRLAEELRQLKAQSHGPERDAPFKSAEALEALQKESRGLDARLQAVEDGVQAAHGAATR
QGERLDALLAKSGEXXXXLGALQERLDGPGAPAEGGLASTVRSLGEAQLSLYSDVEELKR
SVGELPSTVDTLQKVQEQVHTLLGQDQAQAARLPPEDFLDRLSSLDHLKSSVSQVESDLK
MLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVQVEKIHEKV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaagcagggggagagcgagatcaaccggatcagtgaagttctgcagaagctccagaat
gagattctcaaggacctctcggacgggatccatgtggtgaaggatgcccgggagcgggac
ttcacgtccctcgagaacacggtggaggagaggctgatggagctcaccaagtccatcaac
gacaacatcgccatcttcactgaggtccagaagaggagccagaaggaaataaacgatgtg
aaggcgaaggtcacctctctggaagactctgaggggtacaagcaggatttgaaagccttg
aaggaagttgtgaaggaaatacaaacctctctgaagtccaaagaaaaggacatggaggcc
ctgaaaagctccctccagaccatggagtctgatgtctacactgaagtcaaagagctggtg
agcctaaaacaggagcagcagaggttcaaggaggcggctgattcggagcatctcacgctg
caggccctcagcgagaagatcctccggtcggaggaggccacctcccgcctccccgacgag
ctcagcaggctggcggaggagctgcgccagctgaaggcccagtcccacgggccggagcgg
gacgcgcccttcaagagcgcggaggccctcgaagcgctgcagaaagagagccggggcttg
gacgcccggctgcaggctgtggaagacggagtgcaggccgcgcacggggccgccacgcgg
cagggcgagcgcctggacgcgctgctggccaagagcggggagnnnnnnnnnnncctgggc
gccctgcaggagcgcctggacggcccgggcgccccggccgagggcggcctggccagcacc
gtgaggagcctgggggaggcccagctctcgctctacagtgacgtggaggagctgaagaga
agcgtgggcgagctccccagcactgtggacacgctgcagaaggttcaggagcaagtccac
acgctgctaggtcaggaccaggcccaggcggcccgcttgcctccagaggactttctggac
agactttcttctctagaccacctcaaatcctcagtcagccaagtggagtcggacttgaag
atgctcaggactgctgtggacagtttggtggcctactcagtgaaaatagaaaccaacgag
aacaacctggaatcagccaagggtctgctcgatgatctgagaaatgacctggataggttg
tttgtgcaagtggaaaaaattcatgaaaaggtctaa

DBGET integrated database retrieval system