KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545441
Entry
107545441         CDS       T05883                                 
Symbol
LMAN1
Name
(RefSeq) protein ERGIC-53 isoform X1
  KO
K10080  lectin, mannose-binding 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545441 (LMAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107545441 (LMAN1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mna04091]
    107545441 (LMAN1)
Membrane trafficking [BR:mna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    107545441 (LMAN1)
Lectins [BR:mna04091]
 L-type lectins
  107545441 (LMAN1)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin ATG17_like Golgin_A5 AAA_13 KxDL DUF4407
Other DBs
NCBI-GeneID: 107545441
NCBI-ProteinID: XP_016079019
LinkDB
Position
Unknown
AA seq 514 aa
MAGSRQRGLQAKARPLFCAFLLSLSHFVVGSDPAFAGAPGTHGPLPHRRFEYKYSFKGPH
LVQSDGTVPFWAHAGDAIPSSDQIRIAPSLKSQRGSVWTKTKAAFENWEIEVTFRVTGRG
RIGADGLAVWYAENQGLEGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHY
DHQNDGANQALASCQRDFRNKPYPVRAKIIYYQKTLTVMINNGFTPDKNDYEFCAKVENM
VIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISETEKEKYQEEFEHF
QQELDKKKEEFQKDHPDLQGQPADEIFESVGDRELRQIFEGQNRIHLEIKQLNRQLDMIL
DEQRKYVSSLTEEISKRGAGIPGQHGQISQQELDTVVNAQHEILRHVNEVKNSMSETIRL
VSGIQHPGSAGGVYETTQHFNDIKEHLHIVKRDIESLVLRNAPSNERPKCPELPPFPSCL
STVHFILFVVIQTVLFIGYIMYRTQQEAAAKKFF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcgggatccaggcagcggggtcttcaggccaaagctcggccgcttttctgcgccttc
ctgctgtcgcttagtcatttcgtcgtgggaagcgaccccgcgttcgccggtgccccgggc
acgcacgggccgctgccacatcgccgtttcgagtacaaatacagcttcaaggggccgcac
ctggtgcagagcgacgggacagtgcctttctgggcccacgcgggggatgctattccaagt
tcagatcaaattcgaatagcaccatctttaaaaagccaaaggggatcagtgtggacaaag
acaaaagcagcctttgagaactgggaaattgaggtgacttttcgagtgactggaagaggt
cgaattggagctgatggcctggcagtttggtatgcagaaaatcaaggcttggagggtcct
gtgtttggatcagctgatatgtggaatggtgttggaatattcttcgattcttttgacaat
gatggaaagaaaaataatcctgctatagtaattataggcaacaatggacaaatccattat
gaccatcaaaatgatggtgctaatcaagctttagcaagttgccagagggactttcgtaat
aaaccctatcctgtccgggcaaagattatatattaccagaaaacattgacagtaatgatc
aataatggcttcacaccggataaaaatgattatgaattttgtgccaaagtggaaaatatg
gtcatccctgcacaagggcattttggaatatctgctgctactggaggccttgcagatgat
catgatgtcctttctttcctcactttccaattgactgagcctgggaaagagccacctaca
ccagataaagaaatttcagaaacagaaaaagaaaaatatcaggaggaatttgagcacttt
caacaagaattggataaaaaaaaagaagaatttcagaaggaccaccctgaccttcaaggg
caaccagcagatgaaatatttgagagtgtaggagatcgtgagctgagacaaatctttgaa
ggacagaatcgtattcatcttgaaatcaagcagctgaaccgacagttagatatgattctt
gatgaacagagaaaatacgtctcttcattgacggaggagatctctaaaagaggagcagga
atcccagggcaacatggacagatctctcaacaagaactggatactgttgtgaacgctcag
catgagattctgagacatgtaaatgaagtgaagaattctatgagtgaaaccatcaggctg
gtcagcggcatccagcatcctgggtctgcagggggcgtttacgagacaacccagcacttc
aacgacatcaaagagcatcttcacatagtgaagcgggacatagagagcctcgtgctgcga
aacgcgccatcaaatgaaagaccaaaatgcccagaactaccaccatttccatcatgttta
tctacggttcacttcattctatttgtagtgatacaaacggtgttattcattggttacatc
atgtataggactcagcaagaagcagctgccaaaaaattcttttga

DBGET integrated database retrieval system