KEGG   Miniopterus natalensis: 107545549
Entry
107545549         CDS       T05883                                 

Gene name
EMD
Definition
(RefSeq) emerin
  KO
K12569  emerin
Organism
mna  Miniopterus natalensis
Pathway
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107545549 (EMD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107545549 (EMD)
   05414 Dilated cardiomyopathy
    107545549 (EMD)
SSDB
Motif
Pfam: LEM
Other DBs
NCBI-GeneID: 107545549
NCBI-ProteinID: XP_016079142
LinkDB
Position
Unknown
AA seq 227 aa
MGSTRKLYEKKIFEYETQRRRLSPPNSSASSFSYRLSDSDSASVDSDMYDLPKKEDALLY
QSKGYNDDYYEESYLSTRTYGEPDFVGTSKGFRQPSASLSDADTFHHQVRDDNFFSSEED
RERPMYGRDSAYQSIAHYRPVSNITRSSLGLSYYPTSSSTSSMSSSSSSPPSWLTRRAIR
PEKQAPGAGLGQDRQVPLWGQLILFLVFAAFLLLVYYSMQAEDGNPF
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggctccactcgtaagctctacgaaaagaaaatcttcgagtacgagacccagagacga
aggctttcacccccgaactcatctgcatcctcattctcctatcggctctcggactcagat
tcagcgtctgtggactccgatatgtatgatctgcccaaaaaagaagacgccttactttac
cagagcaagggctataatgatgactactatgaggagagttacttgagcaccaggacttat
ggggagcctgattttgtgggcacatccaagggcttccgccagccctcagcttcactctca
gatgctgacacctttcaccaccaggtgcgtgatgacaattttttctcttcagaagaggat
agggaacgccccatgtatggccgggacagtgcctaccagagcatcgcacactaccgccct
gtttccaacatcaccagaagctccctgggcctgtcctattatcccacatcctcctccacc
tcttccatgtcctcatcttcctcttcccccccctcgtggctcacccgccgagccatcagg
ccagaaaagcaggcccctggggcgggcctgggccaggaccgccaggtcccactctggggc
cagctgattcttttcctggtctttgctgccttcctgctcttggtttactactccatgcag
gctgaggatggcaaccccttctaa

DBGET integrated database retrieval system