KEGG   Miniopterus natalensis: 107545649
Entry
107545649         CDS       T05883                                 

Gene name
C7
Definition
(RefSeq) complement component C7 isoform X1
  KO
K03996  complement component 7
Organism
mna  Miniopterus natalensis
Pathway
mna04610  Complement and coagulation cascades
mna05020  Prion disease
mna05171  Coronavirus disease - COVID-19
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    107545649 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107545649 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107545649 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    107545649 (C7)
SSDB
Motif
Pfam: MACPF Sushi Kazal_3 TSP_1 TSP1_spondin Ldl_recept_a
Other DBs
NCBI-GeneID: 107545649
NCBI-ProteinID: XP_016079262
LinkDB
Position
Unknown
AA seq 858 aa
MQTKIMLLFPPQAIGFFILVGFIGQFPAFSSASSPVDCQWGSFGPWSECNGCTKSQTRRR
LIAVHAQYGGQPCTGGAFQTQACEPAQGCPAEEGCGERFRCFSGQCISKSLVCNGDSDCD
EDGADEDRCENAESRLSCDLDKPPPNIELTGNGYNILTGQSRSRVINTKSFGGQCRKVFS
GDGRDYYRLSGNVLSYSFQVKINNDFNYEFYNSSWSYVKETSTVTSSSTNKRSYFGISSS
SSSSKRDYSNFKENQKKKSYQLLVIQNTVEVAQFINNNAEFLQLAEPFWRELSYLPPLYD
YSAYRRLIDKYGTHFLQSGSLGGEYKVLFYVDTEKMKQRGLSSESMKECSSKNVNFVFVT
QSSSKCKELEDALKSATATHSSMLRGLPFVRGGRAGLASGLSFLELDNPAGNQKRYSSWA
GSVTQLPDVIKQKLTPLYELVKEVPCASVKRLYLRRALEEYLDESDPCHCRPCRNGGLAT
VEGTECQCHCKPYTFGAACEQGVLVGDEAGKVDGGWNCWSSWSPCVAGKKTRHRECNNPP
PSGGGAACIGETSESRPCGEGDEELEHLRLLEPHCFPLPSGPRDFCPPPPALDHGFVQDE
GTRFPVGKNIVYTCREGYSLVGDPVARCGDDLQWLVGEMHCQKIACVLPTLMDGVQSHPQ
KPFYTVGDKVTFSCSGGMSLEGPSTFLCGSSLKWSPEIKDAHCVQKDAPVTQAVPKCRPW
EKVKNSRCVCKLPYECRSSLDVCARDEKSRRILPLTVCKVHALRCQGKHFTLTGTASCVL
PAPARRACGACPPWGKCDAEGSTCVCREASECEEGGISICVAVNGEERTMTECEAGALRC
GGQSISVTSISPCEQGTQ
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgcaaactaaaataatgcttttatttcccccccaggcaataggtttcttcatcttggtg
ggatttataggacagttcccggctttttcaagcgcctcctctccagtcgattgccagtgg
ggttccttcggcccttggtcagagtgtaatggttgtaccaagtctcagacccgcaggcgc
ttgatcgccgttcacgcgcagtacggcggccagccgtgcacaggcggggccttccagacg
caggcctgcgagcctgcccaggggtgccctgcggaagaggggtgcggagagcggttcagg
tgtttctcaggccagtgcatcagcaagtctctggtttgcaacggggattctgactgtgac
gaagacggcgctgatgaagacagatgtgagaatgcagagagtagactctcctgcgacctc
gataaacctccccccaacattgaacttactggaaatggttacaatattctcaccggccag
tcccggagcagagtcatcaacacgaaaagctttggtggtcagtgcagaaaggtgttcagt
ggggatggacgagactactacaggctgagcggaaacgtcctctcgtactcatttcaggtg
aaaataaataatgattttaattacgaattttacaacagtagctggtcttacgtaaaagaa
acatcaacagtgacttcatcatctacaaacaaacgctcctatttcggaatttcatcatca
tcttcttcttcaaaacgtgattattcaaatttcaaggaaaatcagaagaaaaagagctac
cagctgctggtgatacagaacaccgtggaggtggcccagttcatcaacaacaacgcggaa
ttcttgcaactggccgagcccttctggagggagctctcctacctgccccctctatacgac
tacagcgcctaccgaaggctgatcgacaagtatgggacgcactttctgcagtccgggtcc
ttgggaggagagtacaaagttctcttttatgtggacacagagaaaatgaaacaaagaggc
cttagctcagaaagtatgaaggaatgtagttccaaaaatgtcaactttgtgtttgttaca
caatcttcaagcaaatgcaaggagctagaggacgccttaaaatcggctacagcgacccac
agcagcatgctgcgagggctcccgtttgtgcggggcggccgtgcgggcctggcgtccggc
ctgagcttcctggagctggataaccccgccggcaaccagaagcgctattcctcctgggcc
gggtctgtcacccagcttcccgacgtcatcaagcaaaaactgacacctttgtatgagctg
gtgaaggaggtgccctgtgcctcggtcaagagactctacctgagacgggctctagaggaa
tacctggacgagtctgacccctgccattgccggccttgtcggaacggtggcctggccacc
gtggaggggaccgagtgtcagtgccattgcaaaccgtacacatttggtgcggcctgtgag
cagggagtcctcgtaggggatgaagcaggaaaggttgatggaggctggaactgctggtcc
tcttggagcccctgtgttgcagggaagaaaacaaggcatcgggaatgcaacaacccccct
cccagtgggggtggggcggcctgcatcggagaaacgtcggagagcaggccctgcggagag
ggagacgaggagctggagcaccttcgattgctcgaaccccattgctttcctttgccttca
ggtccgagggacttctgtccaccaccgcctgccttggaccatggatttgttcaagatgaa
ggcaccaggtttcctgtggggaaaaacatagtctatacctgcagggaaggatactccctg
gtcggagaccctgttgccagatgcggagatgatttacagtggctcgttggggaaatgcat
tgtcagaaaattgcctgtgttctgcctacactgatggatggtgtacagagtcatccccag
aaacctttctacacagtgggagacaaggtgaccttctcctgctcgggtggcatgtcctta
gaaggtccttcgacatttctctgtggatccagccttaaatggagtcctgagataaaagac
gcccattgtgtgcagaaagatgcccctgtgactcaggcagtgcctaagtgtcggccctgg
gagaaggtgaagaattcgagatgtgtttgcaaattgccctacgaatgtcggtcctccttg
gatgtatgtgctcgggacgagaaaagccgcaggatactgcccctgaccgtttgcaaggtg
cacgctctccgctgccagggcaaacacttcactcttacgggcacggccagctgtgtcctg
ccggcccccgcccggagagcctgtggcgcgtgtcccccgtggggcaaatgtgacgccgag
ggcagcacatgtgtctgcagagaagcatcggagtgcgaggagggagggatcagcatctgc
gtggccgtgaacggcgaggagcggacgatgacggagtgcgaggctggcgccctgaggtgc
ggagggcagagcatctccgtcaccagcataagcccctgcgagcagggaacccagtag

DBGET integrated database retrieval system