KEGG   Miniopterus natalensis (Natal long-fingered bat): 107545674
Entry
107545674         CDS       T05883                                 
Symbol
EIF2S1
Name
(RefSeq) eukaryotic translation initiation factor 2 subunit 1 isoform X1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05160  Hepatitis C
mna05162  Measles
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545674 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107545674 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    107545674 (EIF2S1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107545674 (EIF2S1)
   05164 Influenza A
    107545674 (EIF2S1)
   05162 Measles
    107545674 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    107545674 (EIF2S1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545674 (EIF2S1)
   05012 Parkinson disease
    107545674 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    107545674 (EIF2S1)
   05020 Prion disease
    107545674 (EIF2S1)
   05022 Pathways of neurodegeneration - multiple diseases
    107545674 (EIF2S1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107545674 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107545674 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mna03012]
    107545674 (EIF2S1)
Translation factors [BR:mna03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    107545674 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1
Other DBs
NCBI-GeneID: 107545674
NCBI-ProteinID: XP_016079291
LinkDB
Position
Unknown
AA seq 356 aa
MFKICQPICRLFVKCTLFVLTRNFVKESEPSDCTASSVYLKMPGLSCRFYQHKFPEVEDV
VMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKE
KGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFD
DKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVAC
YGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLERTEGLSVLNQAMAVIK
EKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEVDGDDDAEEMEAKAED
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgttcaaaatttgtcaaccaatatgcaggctctttgtgaaatgcactctttttgtactt
accaggaatttcgtgaaggaaagtgagccaagtgactgtacagcctcttcagtatactta
aaaatgccgggtctgagttgtagattttatcaacacaaatttcctgaggtggaagatgta
gtgatggtgaatgtaaggtccatcgctgaaatgggggcttatgtcagcttgctggaatat
aacaatattgaaggcatgattcttcttagtgagttgtccagaaggcgtattcgttctata
aacaaactcatccgaattggcaggaatgaatgtgtggtggtcattagagtggacaaagaa
aaaggatacattgatttgtcgaaaagaagagtttctccagaggaagcaatcaaatgtgaa
gataaattcaccaaatccaaaactgtttacagcattcttcgtcatgttgctgaggtgtta
gagtacaccaaggatgagcaactggaaagcctgttccagaggactgcttgggtctttgat
gacaagtataagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagac
ccatctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataat
attaataggcgtttgactccacaggctgtcaaaattcgagcagatatcgaagtggcttgt
tacggttatgaaggcatcgatgccgtgaaagaagccctgagagcaggtttgaattgttcc
acggaaaccatgcccatcaagattaacctcatagctcctcctcggtatgtaatgactaca
accaccctggagaggacagaaggcctctctgtcctcaaccaggctatggctgttataaaa
gaaaagattgaggaaaagaggggtgtcttcaatgttcaaatggagcccaaagtggtcaca
gatacagatgaaactgaacttgcaaggcagctggagaggcttgagagagaaaatgcagaa
gtggatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system