Macaca nemestrina (pig-tailed macaque): 105496306 Help Entry 105496306         CDS       T08765                                  Symbol GHRH Name (RefSeq) somatoliberin isoform X1   KO K05260   growth hormone-releasing hormone Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04080   Neuroactive ligand-receptor interaction mni04081   Hormone signaling mni04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105496306 (GHRH)    04081 Hormone signaling     105496306 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105496306 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105496306 (GHRH) Cytokines and neuropeptides [BR:mni04052]  Neuropeptides   GPCR binding    105496306 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  105496306 NCBI-ProteinID:  XP_011764935 Ensembl:  ENSMNEG00000044772 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MPLWVFFFVILTLSSSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR QQGERNQERGARARLGRQVDSVWAEQKQMELESILVALLQKHSRNSQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttctttgtgatcctcaccctcagcagcagctcccactgctcc ccacctccccctttgactctcaggatgcggcgatatgcagatgccatcttcaccaacagc taccggaaggtgctgggccagctgtccgcccgcaaactgctccaagacatcatgagcagg cagcagggagagagaaaccaagagcgaggagcaagggcacggcttggccgtcaggtggac agcgtgtgggcagaacaaaagcaaatggaattggagagcatcctggtggccctgctgcag aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system