Malania oleifera: 131151446 Help Entry 131151446         CDS       T09312                                  Name (RefSeq) probable histone H2A variant 2   KO K11251   histone H2A Organism mof  Malania oleifera Pathway mof03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:mof00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131151446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mof03036]     131151446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mof04147]     131151446 Chromosome and associated proteins [BR:mof03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131151446 Exosome [BR:mof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131151446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF DUF1280 Motif Other DBs NCBI-GeneID:  131151446 NCBI-ProteinID:  XP_057958674 LinkDB All DBs Position 3:97035063..97035380 Genome browser AA seq 105 aa AA seqDB search MVLFPFGRIYHLLKSRVTANGRVGSTAAVYSAAVLEYLTAEVQELAGNASKDLKVKRITP RHLQLAIRGDEGLDTLIKGTIAGGGVIPHIQKSHQQILQRLVFKL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgctgttcccctttggccgcatctaccatctcctgaagtctagggtcacagccaat ggaagagtcggttcaacagctgctgtatactcggcagctgtcttggagtacctgactgct gaagtacaggagctggcaggtaacgcaagcaaggatttgaaggtgaagcgtatcacgcct aggcatttgcagcttgcaatacgaggtgatgaagggcttgacaccctcattaaaggaacc atagctggtgggggcgtgattcctcacatccaaaagtctcatcaacaaatcctccaacga ctagtattcaaattgtaa

DBGET integrated database retrieval system