KEGG   Methanothermococcus okinawensis: Metok_0793
Entry
Metok_0793        CDS       T01534                                 

Name
(GenBank) Deoxycytidine triphosphate deaminase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mok  Methanothermococcus okinawensis
Pathway
mok00240  Pyrimidine metabolism
mok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mok00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metok_0793
Enzymes [BR:mok01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     Metok_0793
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: AEH06770
UniProt: F8AM82
LinkDB
Position
810308..810937
AA seq 209 aa
MVKIMILSDRDILEYVESGKLFIEPFNMDFVGPCSYDVTLGDEFIVYNDEVYDLKEKLNH
EKFKIKNSIMVCPLYHKLDDDIIDYYKETYKVDTVVDGGLLGTTNEYIKLSNDVCAQYQG
RSSFGRVFLQSHQTAGWIDAGFMGKITLEIVAYDKPVILYKNQRIGQLIFTKTLSPANVG
YCDRVSSKYGGQDSVMPSLICKELNALKK
NT seq 630 nt   +upstreamnt  +downstreamnt
atggtgaaaataatgatattgagtgatagagatattcttgaatatgtagaatcgggtaaa
ttatttattgaaccatttaatatggattttgttgggccgtgttcttatgatgttacactt
ggagatgagtttatcgtatataacgatgaggtttatgatttaaaggaaaagcttaaccac
gaaaaatttaaaataaaaaattcaataatggtatgtccactatatcataaattagatgat
gatataatagattattataaggaaacatataaagtagatactgtggttgatggaggatta
cttggaactacaaatgaatatataaaattatcaaatgatgtatgtgctcagtatcagggt
aggagttcctttggaagggtatttttacaatctcatcaaacagcaggatggattgatgcc
ggatttatggggaaaattacattggagattgtggcttatgataaaccagtaatactctat
aaaaatcaaaggattggacagttgatatttaccaaaacacttagtcctgcaaatgtaggt
tactgtgatagggtgagctctaaatatggaggtcaggattctgtaatgccatcattaata
tgtaaagagctaaatgctttaaaaaagtaa

DBGET integrated database retrieval system