Mesorhizobium opportunistum: Mesop_4529 Help Entry Mesop_4529        CDS       T01542                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mop  Mesorhizobium opportunistum Pathway mop02024   Quorum sensing mop03018   RNA degradation Brite KEGG Orthology (KO) [BR:mop00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Mesop_4529  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Mesop_4529  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mop03019]     Mesop_4529    03036 Chromosome and associated proteins [BR:mop03036]     Mesop_4529 Messenger RNA biogenesis [BR:mop03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Mesop_4529 Chromosome and associated proteins [BR:mop03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Mesop_4529 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AEH88952 UniProt:  F7YCR2 LinkDB All DBs Position complement(4660681..4660926) Genome browser AA seq 81 aa AA seqDB search MAERSQNLQDLFLNSVRKSKNPLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFDGEESQGA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgatcgcaaaaccttcaggacctgttcctgaattcagttcgcaagagcaag aacccgctcaccatcttcctcatcaacggcgtgaagctgaccggcgtggtcacttcgttc gacaatttttgtgtgttgctgcgccgtgacggtcactcccagctcgtctacaaacacgcc atttccacgatcatgccgagccagccggttcaaatgttcgatggcgaggaaagccagggc gcctga

DBGET integrated database retrieval system