Microtus oregoni (creeping vole): 121445969 Help Entry 121445969         CDS       T08307                                  Symbol Bcl2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism morg  Microtus oregoni (creeping vole) Pathway morg01521   EGFR tyrosine kinase inhibitor resistance morg01522   Endocrine resistance morg01524   Platinum drug resistance morg04064   NF-kappa B signaling pathway morg04066   HIF-1 signaling pathway morg04071   Sphingolipid signaling pathway morg04115   p53 signaling pathway morg04140   Autophagy - animal morg04141   Protein processing in endoplasmic reticulum morg04151   PI3K-Akt signaling pathway morg04210   Apoptosis morg04215   Apoptosis - multiple species morg04217   Necroptosis morg04261   Adrenergic signaling in cardiomyocytes morg04340   Hedgehog signaling pathway morg04510   Focal adhesion morg04621   NOD-like receptor signaling pathway morg04630   JAK-STAT signaling pathway morg04722   Neurotrophin signaling pathway morg04725   Cholinergic synapse morg04915   Estrogen signaling pathway morg04928   Parathyroid hormone synthesis, secretion and action morg04933   AGE-RAGE signaling pathway in diabetic complications morg05014   Amyotrophic lateral sclerosis morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05145   Toxoplasmosis morg05152   Tuberculosis morg05161   Hepatitis B morg05162   Measles morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05200   Pathways in cancer morg05206   MicroRNAs in cancer morg05207   Chemical carcinogenesis - receptor activation morg05210   Colorectal cancer morg05215   Prostate cancer morg05222   Small cell lung cancer morg05226   Gastric cancer morg05417   Lipid and atherosclerosis morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121445969 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     121445969 (Bcl2)    04630 JAK-STAT signaling pathway     121445969 (Bcl2)    04064 NF-kappa B signaling pathway     121445969 (Bcl2)    04066 HIF-1 signaling pathway     121445969 (Bcl2)    04071 Sphingolipid signaling pathway     121445969 (Bcl2)    04151 PI3K-Akt signaling pathway     121445969 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121445969 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     121445969 (Bcl2)    04215 Apoptosis - multiple species     121445969 (Bcl2)    04217 Necroptosis     121445969 (Bcl2)    04115 p53 signaling pathway     121445969 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121445969 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121445969 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     121445969 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     121445969 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121445969 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     121445969 (Bcl2)    04722 Neurotrophin signaling pathway     121445969 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121445969 (Bcl2)    05206 MicroRNAs in cancer     121445969 (Bcl2)    05207 Chemical carcinogenesis - receptor activation     121445969 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     121445969 (Bcl2)    05226 Gastric cancer     121445969 (Bcl2)    05215 Prostate cancer     121445969 (Bcl2)    05222 Small cell lung cancer     121445969 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121445969 (Bcl2)    05161 Hepatitis B     121445969 (Bcl2)    05162 Measles     121445969 (Bcl2)    05168 Herpes simplex virus 1 infection     121445969 (Bcl2)    05169 Epstein-Barr virus infection     121445969 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     121445969 (Bcl2)    05152 Tuberculosis     121445969 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121445969 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121445969 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     121445969 (Bcl2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121445969 (Bcl2)    05418 Fluid shear stress and atherosclerosis     121445969 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     121445969 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121445969 (Bcl2)    01524 Platinum drug resistance     121445969 (Bcl2)    01522 Endocrine resistance     121445969 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:morg01009]     121445969 (Bcl2) Protein phosphatases and associated proteins [BR:morg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      121445969 (Bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  121445969 NCBI-ProteinID:  XP_041504107 LinkDB All DBs Position Unknown AA seq 236 aa AA seqDB search MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAVPPGTAPTAGIFSFQPESNPTPA VHRDMAARTSPLRPIVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHNWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtatatccat tataaactgtcacagaggggctacgagtgggatgcgggagatgcggacgccgtgcccccg gggaccgcccccaccgctggcatcttctcctttcagcctgagagcaaccccacgcccgct gtgcaccgggacatggctgccaggacgtcgccactaaggcccatagtcgccaccgctggg cctgcgctcagcccggtgccacctgtggtccacctgactctccgccgggctggggatgac ttctcccgtcgctaccgtcgcgacttcgcggagatgtccagtcagctgcacctgacgccc ttcaccgcgaggggacgctttgctacggtggtggaggaactcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg catctgcacaactggatccaggataacggaggctgggatgcctttgtggaactgtacggt cccagcgtgcggcccctgtttgatttctcctggctgtctctgaagaccctgctcagcctg gccctggtgggggcctgtatcactctgggtgcctacctgggccataagtga

DBGET integrated database retrieval system