Microtus oregoni (creeping vole): 121457011 Help Entry 121457011         CDS       T08307                                  Symbol Ccl5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04062   Chemokine signaling pathway morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04623   Cytosolic DNA-sensing pathway morg04668   TNF signaling pathway morg05020   Prion disease morg05142   Chagas disease morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05168   Herpes simplex virus 1 infection morg05323   Rheumatoid arthritis morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     121457011 (Ccl5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121457011 (Ccl5)    04061 Viral protein interaction with cytokine and cytokine receptor     121457011 (Ccl5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121457011 (Ccl5)    04621 NOD-like receptor signaling pathway     121457011 (Ccl5)    04623 Cytosolic DNA-sensing pathway     121457011 (Ccl5)    04062 Chemokine signaling pathway     121457011 (Ccl5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     121457011 (Ccl5)    05168 Herpes simplex virus 1 infection     121457011 (Ccl5)    05163 Human cytomegalovirus infection     121457011 (Ccl5)   09174 Infectious disease: parasitic    05142 Chagas disease     121457011 (Ccl5)   09163 Immune disease    05323 Rheumatoid arthritis     121457011 (Ccl5)   09164 Neurodegenerative disease    05020 Prion disease     121457011 (Ccl5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121457011 (Ccl5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121457011 (Ccl5)    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121457011 (Ccl5) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Chemokines    121457011 (Ccl5) Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Chemokines    121457011 (Ccl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121457011 NCBI-ProteinID:  XP_041521561 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKISAVALAIILTAATLCAPASASPYGADTTPCCFSYLSLTLPRAHVREYFYTSSKCSNS AVVFVTRKNRQVCANPKKKWVQEYINYLEMK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagatctccgcagttgccctcgccatcatcctcactgctgccaccctctgtgctcct gcatccgcctctccgtatggcgcggacaccactccctgctgcttctcctacctctccctc acgctgcctcgtgcccatgtcagagagtatttctacaccagcagcaagtgctccaactcc gcagtcgtctttgtcacccgtaagaaccgtcaagtgtgtgccaatccaaagaagaagtgg gttcaagaatacatcaactatttggagatgaagtag

DBGET integrated database retrieval system