Microtus oregoni (creeping vole): 121457315 Help Entry 121457315         CDS       T08307                                  Symbol Pth Name (RefSeq) parathyroid hormone   KO K05261   parathyroid hormone Organism morg  Microtus oregoni (creeping vole) Pathway morg04080   Neuroactive ligand-receptor interaction morg04928   Parathyroid hormone synthesis, secretion and action morg04961   Endocrine and other factor-regulated calcium reabsorption morg05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121457315 (Pth)  09150 Organismal Systems   09152 Endocrine system    04928 Parathyroid hormone synthesis, secretion and action     121457315 (Pth)   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     121457315 (Pth)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     121457315 (Pth)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121457315 (Pth) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   Neuropeptides (GPCR binding)    121457315 (Pth) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Parathyroid Motif Other DBs NCBI-GeneID:  121457315 NCBI-ProteinID:  XP_041521891 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MSATAMAKVMIVTLAVCLLAQIDGKPVKKRAVSEIQLMHNLGKHLASVERMQWLRKKLQD VHNFVSLGVQMAARDGGFQRPAKKEENVLVDANPKSLGEGDKADVDVLVKAKPQ NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtctgcaacagcgatggctaaagtcatgatcgtcacgctggccgtttgtcttctcgcc caaatagacgggaaacccgttaagaagagagctgtcagtgaaatacagctgatgcacaac ctaggcaagcacctggcctccgtggagaggatgcaatggctgagaaagaagctgcaagat gtgcacaattttgtcagccttggagttcaaatggctgccagagatggtggtttccagagg cccgccaagaaagaggaaaacgtccttgttgatgccaacccgaaaagtcttggagaggga gacaaagctgatgtggatgtattagttaaggctaagcctcagtaa

DBGET integrated database retrieval system