KEGG   Mycobacterium paragordonae: C0J29_08285
Entry
C0J29_08285       CDS       T06847                                 
Name
(GenBank) hypothetical protein
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00333  Prodigiosin biosynthesis
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C0J29_08285
Enzymes [BR:mpag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     C0J29_08285
SSDB
Motif
Pfam: Aminotran_3 GMC_oxred_N GMC_oxred_C FAD_binding_3 DAO FAD_binding_2 Lycopene_cycl NAD_binding_8 Pyr_redox_2 HI0933_like Thi4 Aminotran_1_2 Pyr_redox_3 Pyr_redox
Other DBs
NCBI-ProteinID: AYE94776
UniProt: A0A386U2L0
LinkDB
Position
1786825..1789779
AA seq 984 aa
MTFHEFVEEHLHSSTHLSRRHVHPKLLYMFELAGMDAVFTRASGAHLWTEDGRKFLDLLS
GGGVHFIGRNHPQVRAALRDVLDMELPNLSVANASVLGGLLAERLISLAGPQFKKVVFAN
SGTEATEICVRFTRQATGRRRYLYLDGAFHGRTYAAISLCGFDEMKITADPLMPTCTPLP
RNDIDALRRELSYGDVAAFVVEAVQGMTCEVVSAEYLREAQQLCAQYGTALVMDEVQTGL
GRLGHWFGCHGAGVQPDMLTVSKALSGGQAPVSAVLLTQDIYDRVYAAFKSGPIYISTFA
ENNLAMAAGLATLDVLEDLDAPNRARDLSDKFRSGLKDLADRYDVIDRITGQGLIIGVVF
KKSANLALRVQQTLMGIGDPGAFAAAVHIDLHRRGILVQIPGFNLNMIKLLPPVTLTDDD
VRLFLREFEEVLAAYRRPTSGPVVAMAGGVTRHVLNEARTKLQARRPAPDGDLKKDQKKT
ARVQEHSDYQGALALDCDVCVVGSGPAGTMLARRLAIAGLDVVVLEAGAAMRQRDRGAEA
GEMFTRWFWDGGMRTTRGNVVIPTLQARCLGGGSVVNSGICMRAPDFVFQKWATEHGVDG
VTSADMARHYDAVEKFLGVRPVQADVQGRRNELFRDGAEALGYQVEPLRRNEHDCRGSGQ
CIVGCPTGAKQSMDRRGIPELLQAGGRVYTSVHVDRLLRQGNRVRGVGGAAIDPTTGRRT
RRVRVNARCTVLAAGAFASPQILQRSGHSADALGRNVRMHPGLMVMGIFDEDISPWNGAT
QGFHVTGFLEEGIKLESIWATPSILGMMHPGIGEGFVRSLADYAHVATWTVWVNGQDSVG
HVRARPRGAASLRYDVGAGDVRRMQEGAARLAEMFAAAGARSVVPGMHGLAPRYDAAEAA
DAIRAAHLAAQDFRVVANHVFGSTAMGADPQRHVTDSWGAVYGLENVYVCDTGLFPSSPS
ANPMLTAMALADRQADMLERQYGR
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgacgtttcacgagttcgtcgaggagcacctgcactccagcacacacctgtccaggcgt
catgtgcatcccaagctgctgtacatgttcgaactcgccggcatggacgccgttttcacc
cgagccagcggtgcgcacctgtggaccgaggacgggcgcaaattcctggatctgctgagt
ggcgggggagtgcacttcatcgggcgcaatcacccgcaggtccgcgccgccctgcgcgac
gtcctcgatatggagctgcccaatctgtccgtcgccaacgcatcggtgttgggcggcctg
ctggccgagcgattgatctccctggccgggccgcaattcaagaaggtggtgttcgccaac
tccggcaccgaggcaacggagatctgcgtccggttcacccgccaggccaccggtcggcgt
cgttacctgtatctggacggggcatttcacgggcgcacctatgccgcgatttcgctctgc
ggcttcgacgagatgaagatcaccgcggatccgctgatgccgacatgtacgcccctgccg
cgcaacgatattgatgccttacgccgcgagctgagctacggcgacgttgccgccttcgtc
gtcgaagcggtgcaaggcatgacctgtgaagtcgtgtcggccgaatacctgcgcgaagcg
caacagctctgcgcgcagtacggcacggcgctggtcatggacgaggtgcagacgggtctc
ggacggctcggtcactggttcgggtgccacggagccggcgtacagccggacatgctcacc
gtcagcaaggccctgtccggtggccaggcgccggtgagcgcggtgttgctgacccaggat
atctacgaccgcgtgtacgccgctttcaagtccgggcccatctacatttcgacgttcgcc
gaaaacaacctagccatggccgccgggctggcgaccctcgatgtgctcgaagatctagac
gcgcccaatcgtgcccgcgatctgtccgacaagttccgcagtggcttaaaggatttggct
gatcgctatgacgtcatcgaccgaatcacggggcagggcctgatcatcggcgtggtgttc
aagaagtcggcgaacctggcgctgagggtgcagcagacgctgatgggtatcggggatccg
ggggcgtttgcggccgcggtgcacattgatctgcatcgccgcggaatcctggtgcagata
ccgggattcaacctcaacatgatcaagctgctgccgccggtgaccctcacagacgatgat
gtgcggttgtttctgcgcgagttcgaagaggtgctcgccgcgtatcggcggcccacttct
ggtccggtcgtcgccatggcaggcggcgtcacacggcacgtactgaacgaagcgcggacc
aagctgcaggcgcgtcggcccgcgcccgacggcgatcttaagaaagaccagaagaaaacc
gcacgcgtacaggagcattcggactaccagggcgcgctggccctggactgcgatgtttgt
gtggtcggctcgggaccggccggcacgatgctcgcgcgtcggttggcgatcgcgggactc
gacgtcgtggtactcgaagcaggagcggcgatgcgccagcgcgaccggggcgctgaggcc
ggcgagatgttcacccggtggttctgggacggcggaatgcgcaccacgcgtggcaatgtc
gtcatacccaccctgcaggcgcgatgtctcggcggcggttcggtcgtgaattccggcatc
tgcatgcgggcgcccgattttgtgttccagaagtgggcaaccgagcacggcgtcgacggg
gtcacgtctgcagatatggcccgccactacgacgcggtcgagaagttcctgggtgttcgc
ccagtccaggcagacgtgcaaggtcgacgcaatgagctgttccgtgacggggccgaagcg
cttggctaccaggtggaaccgctgcgtcgaaacgagcatgactgccgcggttcgggccag
tgcatcgtgggatgcccgaccggggcgaagcagtcgatggaccgtcgcggaattcccgaa
ctactgcaagccggtggccgcgtatacacctcagtacacgtcgatcgtctactgcgacag
ggtaatcgggtgcgcggggtgggcggcgccgcgatcgatccgaccaccgggcggcgcaca
cgtcgggtgcgggtcaacgcgagatgcacggtgctggccgccggcgctttcgcctcaccg
caaatcttgcagcgcagcggacacagtgcggatgccctgggccgcaacgttcggatgcat
ccgggcctgatggtcatggggatcttcgacgaggacatctccccatggaacggcgcgacg
cagggttttcacgtcaccggattcctcgaggaaggcatcaagctcgagtcgatctgggcg
accccgtcgattctgggcatgatgcacccgggcatcggcgaaggctttgtgcgatcgctg
gccgattacgcacatgtggcgacttggaccgtgtgggtgaacgggcaggattcggtcgga
cacgtgcgggcgaggccgcgcggagcggcgagcctgcgttacgacgtcggggccggtgac
gtccgccgcatgcaggagggcgctgcacggttggctgagatgttcgcggccgcaggtgcc
cgcagtgttgtgccagggatgcacggcttggccccgcgttacgacgctgccgaggcagcg
gatgcgatccgtgcagcgcacctggcggcgcaggactttcgcgtcgtcgcgaaccatgtc
ttcgggtcgacggcgatgggagcggacccgcagcgtcacgtcacggactcctggggggcg
gtatacggccttgagaacgtatacgtctgtgacacagggcttttcccgtcgagcccatcg
gccaacccgatgctcacggcgatggctcttgccgaccgtcaggcggacatgctggagcgg
cagtacgggcgctga

DBGET integrated database retrieval system