KEGG   Mus pahari (shrew mouse): 110312867
Entry
110312867         CDS       T05929                                 

Gene name
Prkab1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110312867 (Prkab1)
   04068 FoxO signaling pathway
    110312867 (Prkab1)
   04152 AMPK signaling pathway
    110312867 (Prkab1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110312867 (Prkab1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110312867 (Prkab1)
   04922 Glucagon signaling pathway
    110312867 (Prkab1)
   04920 Adipocytokine signaling pathway
    110312867 (Prkab1)
   04921 Oxytocin signaling pathway
    110312867 (Prkab1)
  09149 Aging
   04211 Longevity regulating pathway
    110312867 (Prkab1)
   04213 Longevity regulating pathway - multiple species
    110312867 (Prkab1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110312867 (Prkab1)
   04714 Thermogenesis
    110312867 (Prkab1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110312867 (Prkab1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110312867 (Prkab1)
   04931 Insulin resistance
    110312867 (Prkab1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 110312867
NCBI-ProteinID: XP_021042459
Ensembl: MGP_PahariEiJ_G0024215
LinkDB
Position
23
AA seq 270 aa
MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHSEEIKAPEKEEF
LAWQHDLEVNDKAPTQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgcgccgcgctggagcggcaggcgggccacaagacgccg
cggagggacagctccgggggcaccaaggatggggacaggcccaagatcctcatggacagc
cccgaagacgccgacatcttccactcggaggagatcaaggctccagagaaggaggagttc
ttggcctggcagcatgatctggaggtgaatgataaagctcccacccaggcccggcccacc
gtctttcgatggacagggggtggaaaggaagtctacttgtccgggtccttcaacaactgg
agcaagcttcccctcacgagaagccagaataacttcgtagccatcctggacctcccggaa
ggagagcatcagtacaagttcttcgtggatggacagtggacccacgatccctctgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agctcccccccaggaccctaccaccaggagccttacatctctaaaccagaagagaggttc
aaagccccgcccatcctcccgccacacctgctgcaggtcatcttgaacaaggacacgggc
atctcttgtgacccggcgctgcttccggagcctaaccacgtcatgctgaaccacctctac
gccctctccatcaaggatggagtgatggtgcttagcgcaacgcaccggtacaagaaaaag
tatgtcaccaccctgctctacaagcctatatga

KEGG   Mus pahari (shrew mouse): 110315523
Entry
110315523         CDS       T05929                                 

Gene name
Prkag2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110315523 (Prkag2)
   04068 FoxO signaling pathway
    110315523 (Prkag2)
   04152 AMPK signaling pathway
    110315523 (Prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110315523 (Prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110315523 (Prkag2)
   04922 Glucagon signaling pathway
    110315523 (Prkag2)
   04920 Adipocytokine signaling pathway
    110315523 (Prkag2)
   04921 Oxytocin signaling pathway
    110315523 (Prkag2)
  09149 Aging
   04211 Longevity regulating pathway
    110315523 (Prkag2)
   04213 Longevity regulating pathway - multiple species
    110315523 (Prkag2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110315523 (Prkag2)
   04714 Thermogenesis
    110315523 (Prkag2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110315523 (Prkag2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110315523 (Prkag2)
   04931 Insulin resistance
    110315523 (Prkag2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 110315523
NCBI-ProteinID: XP_021045221
Ensembl: MGP_PahariEiJ_G0021798
LinkDB
Position
2
AA seq 568 aa
MGSAAMDTKKKKEVSSPGGSSGKKNPSLKRRSLRVHIPDLSSFAMPLLDGDVENSEKHSS
RKVDSPFSSGSPSRGLSSRGLQPRPSSPVSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPSSNPSTSPGGIRFFSRSRKTSSVSSSPSTPTQVTKQHPFPLESY
KQEPERPESRIYASSSPPDTGQRFCLAFQSPVRPPLASPTYHAPLRTAALAAAPGPAEAG
MLEKLEFQEEAAEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFM
KQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSI
VGIISLSDILQALILTPAGAKQKETETE
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggaagcgcagccatggacaccaagaagaagaaagaggtttccagcccgggcgggagc
agtggcaaaaagaaccctagcctgaagaggcggtcgctgcgagtgcacattccggacctg
agttcctttgccatgccgctgctggatggagatgtggagaattcagagaagcattcttcc
cggaaggtggacagtcccttcagctcaggcagcccctccagaggactctcctccagaggc
ctccagccccggccctccagccctgtgtctgctcctgtgaggcccaagacgagccctggc
tctcccaaaactgtgttcccgttctcctaccaggagtcccctccgcgctctccacgccgg
atgagcttcagtgggatcttccgctcctcatccaaagagtcttcacccagctccaacccg
tctacctctcctgggggcatccgcttcttctcacggtccagaaaaacctccagcgtctcc
tcttctccatcaacacccacccaagtgaccaagcagcacccatttcccctggagtcctac
aagcaggagcctgaacgcccagaaagtcgaatctacgcttcctcgtcccctccagacact
ggccagcgcttctgcctggcctttcagagcccagtgcgacctcctctggcatccccgaca
taccatgctcctttgagaaccgcggcgctggcggcggccccgggacccgcggaagccggc
atgctggagaagctggagttccaggaggaagcagcagaagactcagaaagtggtgtttat
atgcgattcatgaggtcacacaagtgttatgacatcgttccaacaagttcaaagcttgtt
gtcttcgacactacgttgcaagtcaaaaaggccttctttgccttggtagccaacggagtc
cgagcagcaccactgtgggaaagtaaaaagcagagctttgtaggaatgctcacgattaca
gatttcataaacatcctacacagatactataaatcacccatggtacagatttatgaattg
gaagaacataagattgaaacgtggagggagttgtacttacaagaaaccttcaagcctttg
gtgaatatctctccagatgcgagcctcttcgatgctgtatactcgttgatcaaaaataaa
atccacagattgccagttattgaccctatcagtgggaatgcactttatatacttacccac
aaaagaatcctcaagttcctccagctttttatgtctgacatgccaaagcccgccttcatg
aagcagaacctggatgagcttggaatcggaacgtaccacaatattgccttcattcacccg
gacactcccatcatcaaagccttgaacatcttcgtggagagacggatatccgcgttgcct
gtggtggatgagtcaggaaaagttgtagatatttattccaagtttgatgtaattaatctt
gctgctgagaaaacgtacaataacctagacatcacagtgacccaggccctgcagcaccgc
tcgcagtattttgagggtgtggtgaagtgcagtaagctggaaacactggagaccatcgtg
gacaggatagtgagagccgaggtccatcggctggtggtagtgaatgaagcagatagtatc
gtgggtattatctccctgtcagacatcctacaagccctgatccttacaccagcaggtgcc
aaacagaaggagacagagactgagtga

KEGG   Mus pahari (shrew mouse): 110320445
Entry
110320445         CDS       T05929                                 

Gene name
Prkab2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110320445 (Prkab2)
   04068 FoxO signaling pathway
    110320445 (Prkab2)
   04152 AMPK signaling pathway
    110320445 (Prkab2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110320445 (Prkab2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110320445 (Prkab2)
   04922 Glucagon signaling pathway
    110320445 (Prkab2)
   04920 Adipocytokine signaling pathway
    110320445 (Prkab2)
   04921 Oxytocin signaling pathway
    110320445 (Prkab2)
  09149 Aging
   04211 Longevity regulating pathway
    110320445 (Prkab2)
   04213 Longevity regulating pathway - multiple species
    110320445 (Prkab2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110320445 (Prkab2)
   04714 Thermogenesis
    110320445 (Prkab2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110320445 (Prkab2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110320445 (Prkab2)
   04931 Insulin resistance
    110320445 (Prkab2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 110320445
NCBI-ProteinID: XP_021052134
Ensembl: MGP_PahariEiJ_G0026847
LinkDB
Position
4
AA seq 271 aa
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVP
WQQDLDDSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggaaacaccaccagcgagcgggtgtccggggagcgccacggagccaaagctgctcga
gctgaaggcggcggccatggcccgggaaaggagcacaagatcatggtggggagcaccgac
gaccccagcgtcttcagcctgcccgactccaagctccccggggacaaagagtttgtgccc
tggcagcaggatttggatgattctgtgaagcccgcccagcaggcccggcccaccgttatc
cgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagcacc
aagatccctctgattaagagtcataatgactttgttgccatcctggatcttccagaggga
gagcaccagtacaagttctttgtggatggacagtgggttcatgatccatcagagcctgtg
gttaccagtcagcttggcacaattaataatttaatccatgtcaagaaatctgattttgaa
gtatttgacgctttaaagttagactctatggaaagctctgagacatcatgtcgagacctg
tccagctcaccccctgggccttatggtcaagaaatgtatgtgtttcgatctgaggaaaga
ttcaaatccccacccatcctgccccctcacctactccaagttattcttaacaaggacacg
aatatttcatgtgacccagccttacttcccgagcccaatcatgttatgctgaaccatctc
tatgcactgtccattaaggacagcgtgatggtccttagcgccacccaccgctacaagaag
aagtatgtcaccacgctgctgtataagcccatctga

KEGG   Mus pahari (shrew mouse): 110322106
Entry
110322106         CDS       T05929                                 

Gene name
Prkag3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110322106 (Prkag3)
   04068 FoxO signaling pathway
    110322106 (Prkag3)
   04152 AMPK signaling pathway
    110322106 (Prkag3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110322106 (Prkag3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110322106 (Prkag3)
   04922 Glucagon signaling pathway
    110322106 (Prkag3)
   04920 Adipocytokine signaling pathway
    110322106 (Prkag3)
   04921 Oxytocin signaling pathway
    110322106 (Prkag3)
  09149 Aging
   04211 Longevity regulating pathway
    110322106 (Prkag3)
   04213 Longevity regulating pathway - multiple species
    110322106 (Prkag3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110322106 (Prkag3)
   04714 Thermogenesis
    110322106 (Prkag3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110322106 (Prkag3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110322106 (Prkag3)
   04931 Insulin resistance
    110322106 (Prkag3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 110322106
NCBI-ProteinID: XP_021054285
Ensembl: MGP_PahariEiJ_G0027511
LinkDB
Position
5
AA seq 489 aa
MEPELEHTLPGTLTWSHSGGPESQEMDFLEQGENSWPSPAVATSSERACAIRGVKASRWT
RQETVEEAEPPGLGEGAQSRPAAESTRQKATFPKATPLAQAVPLAEAETSPIGWDLLLPD
CAASAVGSSTGDLELTIEFPAPEAWDYELEGPGKDRSRSGPSPQAPLLGLSWDDELQKPG
AQVYMHFMREHTCYDAMATSSKLVIFDTTLEIKKAFFAMVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPNDSLFEAVYAL
IKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIFGALLPRPSFLCRTIQDLGIGTFRDLA
VVLETAPVLTALDIFVDRRVSALPVVNESGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALSA
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggagcccgagctggagcacacactgcctgggaccctgacctggagccacagtgggggt
ccagagagtcaagagatggacttcttagaacaaggagaaaactcatggccctcaccagct
gtggccaccagctcagaaagagcctgcgccatacggggagtcaaggcttcgagatggacg
agacaggagaccgtagaggaagcagagccaccaggtttgggagaaggtgcccagtccaga
ccagctgctgagtccaccaggcagaaggccacattcccgaaggccacacccttggctcaa
gctgttcccttggctgaagcggagacctcccccatagggtgggacctgctcttacccgac
tgtgcagcctcagcagtgggctccagcacaggtgacttggagctgaccatagagttccca
gccccagaggcctgggactatgagctggaaggccctgggaaggacaggtctcggtctggt
ccatcgccacaggccccacttctcggcctgagttgggatgacgaacttcagaagcccgga
gcccaggtctacatgcacttcatgcgggaacacacctgttatgatgccatggctaccagc
tccaaactggtcatctttgacaccacgctggagataaagaaggctttctttgccatggtg
gccaacggtgtgagggcagcccctctgtgggacagcaagaagcagagctttgtgggcatg
ctcaccatcactgacttcatcctggtgctgcaccggtactacagatcccccctggtccag
atctacgagattgaagaacataagattgagacctggagggagatctacctacaaggctgc
ttcaagcctctagtctccatctctcccaatgacagtctgtttgaagctgtctatgccctc
atcaagaaccgaatccaccgcctgccagtcctggacccggtctccggcactgtgctctac
atactcacacacaagcggctactcaagttcctgcatatatttggtgccctgttgccccgg
ccctccttcctctgccgcaccatccaagacttgggcatcggcacattccgagatttggct
gtagttctggaaacagctcctgtcctgactgcgctggacatctttgtggaccgacgtgtg
tctgcactgcctgtggtcaatgaatctggtcaggttgtgggcctctactcccgctttgat
gtcattcatctggctgcccagcaaacctacaaccacctagacatgagtgtgggagaagct
ctgagacagaggacactatgtctggagggagttctctcctgccagccccacgagagccta
ggtgaagtcattgacaggatcgcacgggaacaggtgcataggctggtgttggtggatgag
acccagcatcttctgggtgtggtctccctctctgatatacttcaagcgctggtgctcagc
cctgctggaatcgatgccctcagtgcctga

KEGG   Mus pahari (shrew mouse): 110323060
Entry
110323060         CDS       T05929                                 

Gene name
Prkaa2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110323060 (Prkaa2)
   04068 FoxO signaling pathway
    110323060 (Prkaa2)
   04151 PI3K-Akt signaling pathway
    110323060 (Prkaa2)
   04152 AMPK signaling pathway
    110323060 (Prkaa2)
   04150 mTOR signaling pathway
    110323060 (Prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110323060 (Prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110323060 (Prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110323060 (Prkaa2)
   04922 Glucagon signaling pathway
    110323060 (Prkaa2)
   04920 Adipocytokine signaling pathway
    110323060 (Prkaa2)
   04921 Oxytocin signaling pathway
    110323060 (Prkaa2)
  09149 Aging
   04211 Longevity regulating pathway
    110323060 (Prkaa2)
   04213 Longevity regulating pathway - multiple species
    110323060 (Prkaa2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110323060 (Prkaa2)
   04714 Thermogenesis
    110323060 (Prkaa2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110323060 (Prkaa2)
   05410 Hypertrophic cardiomyopathy
    110323060 (Prkaa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110323060 (Prkaa2)
   04931 Insulin resistance
    110323060 (Prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110323060 (Prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323060 (Prkaa2)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110323060 (Prkaa2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     110323060 (Prkaa2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   110323060 (Prkaa2)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110323060 (Prkaa2)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110323060 (Prkaa2)
  Mitophagy factors
   Other mitophagy factors
    110323060 (Prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like ABC1 Kdo APH YukC TCAD9
Other DBs
NCBI-GeneID: 110323060
NCBI-ProteinID: XP_021055766
Ensembl: MGP_PahariEiJ_G0028562
LinkDB
Position
6
AA seq 573 aa
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVSDIFSRVSF
SPKLRKWKELEVEEVEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFG
LSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHV
PTLFKKIRGGVFYIPDYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPE
DPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASE
FYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKK
AKWHLGIRSQSKACDIMAEVYRAMKQLGFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYL
VDSRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRARSSFDSSTAENHSLSGSLTGS
LTGSTLSSASPRLGSHTMDFFEMCASLITALAR
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtgctgggggac
accctgggcgtcggcaccttcggcaaagtgaagattggagaacaccaactgacaggccat
aaagtggcagttaagatcttaaatagacagaagattcgcagtttagatgttgttggaaag
ataaaacgagaaattcagaatcttaaactctttcgtcatcctcatattatcaaactctac
caggtgatcagcactccgacagacttttttatggtaatggaatatgtgtctggaggtgaa
ttatttgactacatctgcaaacatggacgggtgagtgacatattttctagggtatctttc
agccccaagctaagaaagtggaaggaactggaagttgaagaggtggaagctcgccggctc
ttccagcagatcctgtctgccgtggattactgtcacaggcatatggttgtccacagggac
ttgaaaccagagaatgtgctgctggatgcccagatgaacgctaagatagctgactttgga
ctatctaatatgatgtcagatggtgaatttctacgaactagctgtggatcgccaaattat
gcagcacctgaggtcatctcaggaaggctgtatgcaggtcccgaggtcgacatctggagc
tgtggtgtcatcctgtatgcccttctctgtggcaccctccctttcgatgatgagcacgtg
cctacgctctttaagaagatccgagggggcgtgttttacatcccagactatctcaaccgt
tctgttgccactctgctgatgcacatgctccaggtggaccccctgaagcgagcgactatc
aaagacatacgagaacatgagtggtttaaacaggatttgcccagctacctattccctgaa
gacccctcctacgatgcgaacgtcattgacgatgaggctgtgaaggaagtctgtgagaaa
ttcgagtgtacagagtcagaagtgatgaacagtctgtatagtggtgacccgcaagatcag
cttgcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgag
ttctacctcgcctctagtcctccatcaggttcttttatggatgacagcgccatgcatatt
cctccaggcctgaaaccacatccagaaaggatgccacctctcatcgcagacagccccaaa
gcacgctgtccactggatgcactcaacacaacgaagcccaagtctctagctgtgaaaaaa
gccaagtggcatcttggaatccgaagccagagcaaagcgtgtgacattatggctgaagtg
taccgagctatgaagcagctgggttttgaatggaaggtagtgaatgcataccatcttcga
gtaagaagaaaaaacccagtgaccggcaactatgtgaaaatgagcttacagctttacctg
gtagacagtcggagctatcttctggactttaaaagcatcgatgatgaggtggttgagcag
aggtctggttcttcaacaccccagcgctcctgttctgctgcgggcctccacagagcacgg
tcaagctttgattccagcacagctgagaaccattccctttctggctctctcactggttct
ttgactggcagcactttgtcctcggcttccccgcgcctgggcagtcacaccatggatttt
tttgaaatgtgcgccagtcttatcactgctttagctcgttga

KEGG   Mus pahari (shrew mouse): 110328784
Entry
110328784         CDS       T05929                                 

Gene name
Prkaa1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110328784 (Prkaa1)
   04068 FoxO signaling pathway
    110328784 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    110328784 (Prkaa1)
   04152 AMPK signaling pathway
    110328784 (Prkaa1)
   04150 mTOR signaling pathway
    110328784 (Prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110328784 (Prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110328784 (Prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110328784 (Prkaa1)
   04922 Glucagon signaling pathway
    110328784 (Prkaa1)
   04920 Adipocytokine signaling pathway
    110328784 (Prkaa1)
   04921 Oxytocin signaling pathway
    110328784 (Prkaa1)
  09149 Aging
   04211 Longevity regulating pathway
    110328784 (Prkaa1)
   04213 Longevity regulating pathway - multiple species
    110328784 (Prkaa1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110328784 (Prkaa1)
   04714 Thermogenesis
    110328784 (Prkaa1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110328784 (Prkaa1)
   05410 Hypertrophic cardiomyopathy
    110328784 (Prkaa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110328784 (Prkaa1)
   04931 Insulin resistance
    110328784 (Prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110328784 (Prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328784 (Prkaa1)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110328784 (Prkaa1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     110328784 (Prkaa1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   110328784 (Prkaa1)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110328784 (Prkaa1)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110328784 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    110328784 (Prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like ABC1 APH Kdo TCAD9 FTA2
Other DBs
NCBI-GeneID: 110328784
NCBI-ProteinID: XP_021063893
Ensembl: MGP_PahariEiJ_G0016017
LinkDB
Position
11
AA seq 574 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
REVDLESLVFEGTLKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAK
IADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF
DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPK
YLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIM
NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
KWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQV
DSRTYLLDFRSIDDEITEAKSGTATPQRSGSISNYRPCQRSDSDAEAQGKPAEVSLTSSV
TSLDSSPVDVAPRPGSHTIEFFEMCANLIKILAQ
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggcgtcggcaccttcggcaaa
gtgaaggtgggcaagcacgagttgaccggacacaaagttgctgtgaagatactcaaccgg
cagaagatccggagccttgacgtggtcgggaaaatccgtcgagagattcagaacctgaag
ctcttcaggcacccacacatcatcaaactgtaccaggtcatcagcacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgactatatctgtaaaaatgga
agggaagtagacttagagagtttagtgttcgaaggaaccttgaaggagttggacgaaaag
gaaagtcgacgtctgttccagcagatcctttctggtgtggactattgtcataggcatatg
gtggtccacagagatttgaaacctgaaaacgtcctgcttgatgcacacatgaatgcaaag
atagccgactttggtctttcaaacatgatgtcagatggtgaatttttaagaacaagctgt
ggctcacccaattatgctgcacccgaggtcatttcaggaagattgtacgcaggccccgag
gtggacatctggagcagtggggtcattctctatgctttgctgtgtggaaccctccctttt
gatgatgaccatgtgccaactctttttaagaagatatgtgatgggatcttttatacccct
cagtatttaaatccctcagtaatcagccttttaaagcatatgctgcaggtagatcccatg
aagagggccacaataaaagatatcagggaacatgagtggtttaaacaagaccttccgaag
tatctctttcctgaggacccgtcttatagttcaaccatgatagatgacgaagccttgaaa
gaagtgtgtgagaagttcgagtgttcggaggaggaggtcctcagctgcctgtacaacaga
aaccaccaggacccactggccgtcgcctaccacctcataatagacaacaggagaataatg
aacgaagccaaagatttctacctggcaaccagcccacccgactctttcctggatgaccac
catttaactcggcctcaccctgaaagagtaccgttcttggttgccgaaacaccacgggcc
cggcacaccctggatgaattaaacccacagaaatccaaacaccaaggtgttcggaaggca
aaatggcatttgggaattcgaagtcaaagccgacccaatgatatcatggcagaagtatgt
agagcaatcaagcagttggattatgaatggaaggttgtaaacccctattatttgcgtgta
cgaaggaagaatcctgtgacaagcacattttccaaaatgagtctacagctataccaagtg
gatagtaggacttacttgttggatttccgtagtattgatgatgagattacagaagccaaa
tcagggactgctactccacagaggtcgggatccatcagcaactatcggccttgccaaagg
agtgactccgatgctgaggctcaaggcaagcctgcagaagtctctcttacctcatctgtg
acctccctcgactcctctcctgtcgacgtagctccaagaccaggaagtcacacaatagaa
ttttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

KEGG   Mus pahari (shrew mouse): 110334696
Entry
110334696         CDS       T05929                                 

Gene name
Prkag1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04068  FoxO signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04371  Apelin signaling pathway
mpah04530  Tight junction
mpah04710  Circadian rhythm
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110334696 (Prkag1)
   04068 FoxO signaling pathway
    110334696 (Prkag1)
   04152 AMPK signaling pathway
    110334696 (Prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110334696 (Prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110334696 (Prkag1)
   04922 Glucagon signaling pathway
    110334696 (Prkag1)
   04920 Adipocytokine signaling pathway
    110334696 (Prkag1)
   04921 Oxytocin signaling pathway
    110334696 (Prkag1)
  09149 Aging
   04211 Longevity regulating pathway
    110334696 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    110334696 (Prkag1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110334696 (Prkag1)
   04714 Thermogenesis
    110334696 (Prkag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110334696 (Prkag1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110334696 (Prkag1)
   04931 Insulin resistance
    110334696 (Prkag1)
SSDB
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 110334696
NCBI-ProteinID: XP_021072191
Ensembl: MGP_PahariEiJ_G0020251
LinkDB
Position
17
AA seq 330 aa
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLRELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagctccccagctctagagaatgaacattttcaagagacc
ccggaatcaaacaatagtgtgtacacctccttcatgaagtctcatcgctgctatgacctg
attcccacaagctccaagttggtggtgttcgacacttcgctgcaggtaaagaaagccttt
tttgccctggtgaccaacggtgttcgagctgcccctttgtgggacagtaagaagcagagt
tttgtgggcatgctgaccatcaccgacttcatcaacattctgcaccgatactataagtca
gccctggtgcagatctatgaactggaggagcacaagatagagacctggagagaggtgtac
ctgcaggactcctttaagccacttgtctgcatttctccaaatgccagcttgtttgatgct
gtctcttcattaatccgaaataagattcacaggcttccagttatcgacccagagtccggc
aacaccttgtacatccttactcacaagcggatcctcaagtttctcaagttgtttatcaca
gagttccccaagccggaattcatgtccaaatctctgcgagagctgcaaattggcacctat
gccaacattgccatggtccgtacgaccacgcctgtctacgtggctctgggcatctttgta
cagcaccgagtctccgccttgcctgtggtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgatcaatttggcagcggaaaagacctacaacaacctagatgtgtct
gtgacgaaagccctacagcatcggtcacactactttgagggtgttctcaaatgctacctg
catgagactctggaaaccatcatcaataggctggtggaggcagaggttcaccgtctggtg
gtggtggatgagcatgacgtggtcaagggcatcgtttcgctgtctgacatcttacaggct
ctggtgctcacgggtggagagaagaagccctga

DBGET integrated database retrieval system