KEGG   Mus pahari (shrew mouse): 110312976
Entry
110312976         CDS       T05929                                 
Symbol
Cldn4
Name
(RefSeq) claudin-4
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312976 (Cldn4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110312976 (Cldn4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110312976 (Cldn4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110312976 (Cldn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110312976 (Cldn4)
   04147 Exosome [BR:mpah04147]
    110312976 (Cldn4)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110312976 (Cldn4)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110312976 (Cldn4)
  Exosomal proteins of colorectal cancer cells
   110312976 (Cldn4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl SUR7 Amastin TMEM37
Other DBs
NCBI-GeneID: 110312976
NCBI-ProteinID: XP_021042627
Ensembl: MGP_PahariEiJ_G0024401
LinkDB
Position
23:complement(25128890..25130655)
AA seq 210 aa
MASMGLQVLGISLAVLGWLGVILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG
QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT
AGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCSCPPRSNDKPYSAKYSAARSVPASNYV
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgtccatgggactacaggtcctgggaatctccttggcagtcctgggctggctggga
gtcatcctgagttgtgcgctccccatgtggcgggtgaccgccttcatcggcagcaacatc
gtcaccgcacagaccagctgggagggcctgtggatgaactgcgtggtgcagagcaccggt
cagatgcagtgcaagatgtacgactcgatgctcgccctgccgcaggacctgcaggctgcc
cgagcccttatggtcatcagcatcatcgtgggcgctctggggatgctcctctcagtggtg
gggggcaagtgcaccaactgcatggaggatgagaccgtcaaggccaagatcatgatcacc
gccggagccgtgttcatcgtggcaagcatgctgattatggtgcctgtgtcctggaccgct
cacaacgtcatccgcgacttctacaaccccctggtggcttccgggcagaagagggagatg
ggggcctcgctttacgtcggctgggcggcctccgggctgctgctcctgggaggaggtctc
ctctgctgcagttgcccacctcgtagcaacgacaagccctactcggccaagtactccgcc
gcccgctctgtccctgccagcaactatgtgtaa

KEGG   Mus pahari (shrew mouse): 110312980
Entry
110312980         CDS       T05929                                 
Symbol
Cldn3
Name
(RefSeq) claudin-3
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110312980 (Cldn3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110312980 (Cldn3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110312980 (Cldn3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110312980 (Cldn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110312980 (Cldn3)
   04147 Exosome [BR:mpah04147]
    110312980 (Cldn3)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110312980 (Cldn3)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110312980 (Cldn3)
  Exosomal proteins of colorectal cancer cells
   110312980 (Cldn3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 110312980
NCBI-ProteinID: XP_021042636
Ensembl: MGP_PahariEiJ_G0024402
LinkDB
Position
23:25173838..25175096
AA seq 219 aa
MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcaccggcacgtcgctggccgtgctgggctggctgtgcacc
atcgtgtgctgcgcccttcccatgtggcgcgtttcggccttcatcggcagcagcatcatc
acggcgcagatcacctgggagggcctgtggatgaactgcgtggtgcagagcaccggtcag
atgcagtgcaagatgtacgactcgctgctggccctgccgcaggacctgcaggccgcccga
gccctcatcgtggtgtccatcctgctggccgccttcgggctcctcgtggcgctcgtgggc
gcccagtgtaccaactgcgtacaagacgagacagccaaggccaagatcaccatcgtggcg
ggagtgcttttcctgttggcggctctgctcaccttagtgccagtgtcctggtcggccaac
accatcatcagggatttctataacccgttggtgccggaggcccagaagcgggagatggga
gctgggttgtacgtgggctgggctgccgccgcgctgcagttgctagggggcgccttgctg
tgttgctcctgcccaccgcgcgacaagtacgcacccaccaagatcctctattctgcgccg
cgatccaccggccctggcaccggtaccggcaccgcctacgaccgcaaggactacgtctga

KEGG   Mus pahari (shrew mouse): 110313087
Entry
110313087         CDS       T05929                                 
Symbol
Cldn15
Name
(RefSeq) claudin-15
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313087 (Cldn15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313087 (Cldn15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313087 (Cldn15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110313087 (Cldn15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110313087 (Cldn15)
   04147 Exosome [BR:mpah04147]
    110313087 (Cldn15)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110313087 (Cldn15)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110313087 (Cldn15)
  Exosomal proteins of colorectal cancer cells
   110313087 (Cldn15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 110313087
NCBI-ProteinID: XP_021042785
Ensembl: MGP_PahariEiJ_G0024445
LinkDB
Position
23:27148628..27156750
AA seq 227 aa
MSVAVETFGFFMSALGLLMLGLTLANSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVS
NCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNIDLSKKAKLLAVA
GALHILAGACGMVAISWYAINITTDFFNPLYVGTKYELGPALYLGWSASLLSILGGICVF
STCCCDSKEEPATRAGLPYKPSSVVIPRATSDESDISFGKYGKNAYV
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtcggttgctgtggagaccttcggcttcttcatgtcagccctgggactgctgatgcta
gggctgacccttgcaaacagctactggagagtctctacggtccacggcaacgtcatcacc
accaacaccatcttcgagaacctatggtacagctgtgccaccgactccctgggagtctcc
aactgctgggactttccgtccatgctggccctctccgggtatgtccagggctgccgggcc
ctcatgatcaccgccattctcctgggtttcctgggcctctttctaggcatggtggggctc
cgctgcaccaacgtgggcaacatcgatctctccaagaaggccaagctgctggccgttgca
ggggccctccacatacttgctggagcctgtgggatggtggctatctcgtggtacgccatc
aacatcactaccgacttcttcaaccccctgtatgttggaaccaagtatgaactgggtccc
gccctctacttgggctggagcgcctccttgctctccatcctgggtggcatctgtgtcttt
tccacctgctgctgtgactccaaggaggagccagccaccagggctgggcttccctacaag
ccttcttcagttgtgataccccgcgccacctcggatgagagtgacatcagctttggtaaa
tatggcaaaaacgcatacgtgtag

KEGG   Mus pahari (shrew mouse): 110313198
Entry
110313198         CDS       T05929                                 
Name
(RefSeq) claudin-13-like
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313198
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313198
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313198
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110313198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110313198
   04147 Exosome [BR:mpah04147]
    110313198
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110313198
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110313198
  Exosomal proteins of colorectal cancer cells
   110313198
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 PIRT DUF973 Zip
Other DBs
NCBI-GeneID: 110313198
NCBI-ProteinID: XP_021042874
Ensembl: MGP_PahariEiJ_G0024365
LinkDB
Position
23:19817173..19818458
AA seq 211 aa
MVFSKQEAISFSVTTLGWMGAIVSCVLPIWRVTFPDDETDTDVSVWEGLWHICQAQANRW
IQCTLYDTRLQAAQDIKVSQVFMVICTIGTWLGLLLCVLGDRRFECFMNRNIESTVMKVA
GGVFLSVGLLVLVPLSWVTHNVIHGFFNPLLGYSKKVQMGTSLYLAWTSSVLLLLGGILL
CVNIPACRDFPSSIKIPGVRLSRANNNTSDA
NT seq 636 nt   +upstreamnt  +downstreamnt
atggttttcagcaaacaagaggccatcagcttctctgtgactacactgggctggatgggg
gccattgtgagctgcgtgctgcccatttggagggtgacatttccagatgacgagacagac
acagatgtcagcgtttgggagggtctgtggcacatatgccaggctcaggcaaacaggtgg
atacagtgtacactgtatgacacccggctacaggcagcacaggacataaaagtgtctcaa
gtctttatggtcatctgcaccattggaacctggctgggattgctgctctgcgtgcttggg
gatcggcggttcgagtgctttatgaataggaatattgaaagcacggtcatgaaggtagct
ggtggggtgtttcttagtgttggccttctggtgctggtacccctgtcctgggtaacacac
aacgtcatccatggcttctttaacccattgctgggctattcgaagaaagtacagatgggc
acttccctctacctggcctggaccagctccgtgctgctgctgctggggggcatcctgctc
tgtgtcaacatcccagcatgcagagactttcccagttccattaagatccctggtgtcaga
ctttcaagagccaacaacaacacctcagatgcttga

KEGG   Mus pahari (shrew mouse): 110313250
Entry
110313250         CDS       T05929                                 
Name
(RefSeq) claudin-34-like
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313250
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313250
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313250
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110313250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110313250
   04147 Exosome [BR:mpah04147]
    110313250
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110313250
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110313250
  Exosomal proteins of colorectal cancer cells
   110313250
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin TMEM128
Other DBs
NCBI-GeneID: 110313250
NCBI-ProteinID: XP_021042926
Ensembl: MGP_PahariEiJ_G0031745
LinkDB
Position
X:complement(65214165..65229392)
AA seq 210 aa
MARKRAKWQVGGFAAGTIAWFLCIVSMGLPQWRVWFFQDPMDSKHGMTLVGMWKTCVYHQ
LSNSTFNGVCYKYTYQDDFIPLDIRVAQHLILIASFLGIIATISVIVALWKLNSGRLRKK
PTFNPFRLPGILNITASSIVFLSILYNYLSIIRNDGIAFPPSFHTPSFPDHQKVGTALAM
ATLSCFLFLVGGIIPLSFTLPPRSRVRYTI
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccagaaagcgtgccaagtggcaggtaggaggttttgctgcaggcaccatagcatgg
ttcctttgtattgtttctatgggcctcccacaatggcgagtgtggttctttcaagatccc
atggattccaagcatggcatgaccttagtaggcatgtggaaaacctgcgtttaccaccag
ttaagcaattccacctttaatggagtgtgttacaaatacacctaccaggatgacttcatc
cctctggatattcgagttgcccaacatctgatactcatcgcaagctttcttggcattatt
gccacaatctctgttatcgttgctctttggaaattgaactctgggagactacggaagaaa
cccaccttcaatccattccgtcttccaggaattctgaacatcactgctagcagcattgtc
tttctttccatcttgtacaattacttatcaatcattcgcaacgatgggattgccttcccc
ccatctttccatacaccctccttcccagatcatcaaaaagttggcactgcattggcaatg
gcaactctatcctgtttcttatttcttgtaggtggcataattcccctttctttcactctt
cccccacgttcccgagtgcgctatactatttaa

KEGG   Mus pahari (shrew mouse): 110313291
Entry
110313291         CDS       T05929                                 
Name
(RefSeq) claudin-34-like
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313291
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313291
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313291
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110313291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110313291
   04147 Exosome [BR:mpah04147]
    110313291
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110313291
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110313291
  Exosomal proteins of colorectal cancer cells
   110313291
SSDB
Motif
Pfam: Claudin_2 DUF4293
Other DBs
NCBI-GeneID: 110313291
NCBI-ProteinID: XP_021042973
LinkDB
Position
X:complement(66104393..66105031)
AA seq 212 aa
MLLLSKRANCQVGGFALTSVAWVLCSISTGVPQWRVWYLNETIFSEPTIAFIGMWRVCIY
HQDSKFGSARVCYEYTYHDSFIPLDVRIVQHLLLISNMLGLIATVISIFALRKVYAGKVQ
KKTTHNPFFLSAILNIIASILVLLAVLFNYFSVIHKAGITFPASFHLPVYPPSQRIGIAN
IVASLCALMFLGSGIIFISYTSLVEKQVFAEI
NT seq 639 nt   +upstreamnt  +downstreamnt
atgttgttgctcagcaaaagagccaactgccaagtcggaggttttgctttgacatccgta
gcatgggtcctctgcagcatctccacaggcgtcccacagtggcgagtgtggtacttaaat
gaaacaattttctctgagcctaccatagcctttataggaatgtggagagtctgcatttat
caccaagacagcaaatttggcagtgccagagtgtgctatgaatacacctaccatgacagc
tttatccctttggatgttcgtatcgttcaacacttgttactgatctccaacatgctcgga
ttgattgcaacagttatcagcatttttgctcttcgaaaggtgtatgcagggaaagtacag
aagaaaaccacccacaatccatttttcctttcagccattctcaacatcattgccagtatc
cttgtcctccttgctgtcttattcaattacttctctgtcattcacaaagcaggaattacc
ttcccagcatctttccatttgccagtatacccacctagtcagagaattggaattgctaat
atagtggccagtctgtgtgctctcatgtttttaggcagtggcatcattttcatttcttac
acttctctcgtggaaaagcaagtgtttgctgagatttga

KEGG   Mus pahari (shrew mouse): 110313292
Entry
110313292         CDS       T05929                                 
Symbol
Cldn34
Name
(RefSeq) claudin-34
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313292 (Cldn34)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110313292 (Cldn34)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110313292 (Cldn34)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110313292 (Cldn34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110313292 (Cldn34)
   04147 Exosome [BR:mpah04147]
    110313292 (Cldn34)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110313292 (Cldn34)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110313292 (Cldn34)
  Exosomal proteins of colorectal cancer cells
   110313292 (Cldn34)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin CTV_P13
Other DBs
NCBI-GeneID: 110313292
NCBI-ProteinID: XP_021042974
Ensembl: MGP_PahariEiJ_G0032042
LinkDB
Position
X:131274066..131274701
AA seq 211 aa
MILFNNGSSRQIGGFALSTLGWILCITSMGLPQWRVWYAKEPMISYPSMAFVGVWKACIY
HYDNVSNIRMCYHYSYHDTFIPLDIRVSQHLMLTSSLFLLIAKLAIVYALRNVYTGRQEK
SVTYNAFGLSAILNIIGSSFVFLAVLCSYFSIINKEGIAFPPSFHMPFYPHTQQVGIAMV
MASLAAILFLCSGVIFIPYSFPLNIRVLSNI
NT seq 636 nt   +upstreamnt  +downstreamnt
atgatattgttcaacaatggttccagtcgccagataggaggttttgctctgtctaccttg
ggatggattctttgcatcacctccatgggcctcccacagtggcgcgtgtggtacgcgaag
gaacctatgatctcttatcctagtatggcctttgttggagtgtggaaagcctgcatctac
cactatgacaacgtcagcaatattagaatgtgttaccattacagctaccatgacaccttc
attcctttggatattcgtgtttctcagcacctgatgttgacttccagccttttcttgctg
attgcaaaattggccattgtttatgctcttagaaatgtgtacacaggaagacaagagaag
agtgtgacctacaatgcctttggcctttcagcaattctgaacatcattggcagtagcttt
gtcttccttgctgtcttgtgcagttatttctccatcataaacaaggaggggattgctttt
ccaccatctttccatatgcccttttacccacatactcagcaggttggcattgctatggta
atggcgtctctagcagccatcctgttcttgtgtagtggtgtgattttcatcccttactca
tttcccttaaacatacgagtcctttctaatatctga

KEGG   Mus pahari (shrew mouse): 110314217
Entry
110314217         CDS       T05929                                 
Symbol
Cldn2
Name
(RefSeq) claudin-2
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314217 (Cldn2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110314217 (Cldn2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110314217 (Cldn2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110314217 (Cldn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110314217 (Cldn2)
   04147 Exosome [BR:mpah04147]
    110314217 (Cldn2)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110314217 (Cldn2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110314217 (Cldn2)
  Exosomal proteins of colorectal cancer cells
   110314217 (Cldn2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin DUF973
Other DBs
NCBI-GeneID: 110314217
NCBI-ProteinID: XP_021044326
Ensembl: MGP_PahariEiJ_G0031984
LinkDB
Position
X:118610479..118619253
AA seq 230 aa
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVV
GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI
LCFSCSSQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctactaggc
acatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcatt
gtgacggcggttggcttttccaagggcctgtggatggagtgtgcgacacacagcacaggc
atcacccagtgtgatatctacagtacccttttaggacttcctgctgacatccaggctgcc
caagccatgatggtgacatccagtgcaatgtcctcgctggcttgcattatctctgtggtg
ggcatgagatgcaccgtgttctgccaggaatctcgagctaaggacagagtggctgtagtg
ggtggagtctttttcattcttggtggcatcctgggctttatcccagttgcttggaatctt
catggcatccttcgtgacttctactcaccgctggttcctgacagcatgaaatttgagatt
ggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatc
ctttgcttttcctgctcatcccagggcaatcgtaccaactactatgatggctaccaggcc
cagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgag
ttcaactcatacagcctgactgggtatgtgtga

KEGG   Mus pahari (shrew mouse): 110314553
Entry
110314553         CDS       T05929                                 
Name
(RefSeq) claudin-34-like
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314553
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110314553
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110314553
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110314553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110314553
   04147 Exosome [BR:mpah04147]
    110314553
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110314553
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110314553
  Exosomal proteins of colorectal cancer cells
   110314553
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin
Other DBs
NCBI-GeneID: 110314553
NCBI-ProteinID: XP_021044493
Ensembl: MGP_PahariEiJ_G0031915
LinkDB
Position
X:complement(107538889..107542270)
AA seq 213 aa
MVFFKKSTNHQIRGFALATIAWIMCSTSMGLPEWRVCYLEEPMGSSQSMAFVGMWRACIC
HHVDTSSHQRVCQHYTYHDGLVPLDIRLAQNLLLVANIIGLVGTVCAVFALQQLYTEELE
NNDDNDNPFVLSAVLNAVASTFIFLAVMCNYFSEPSKEGLYFLPSSQMPLFPYAQRAGSA
MGMASISAILFLLSAIIFISYSPSMEKENLPLV
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtcttcttcaaaaagtcaaccaatcaccaaataagaggtttcgccttggccaccatt
gcatggataatgtgcagcacctctatgggccttcctgaatggcgagtttgttatttggaa
gaacccatgggttcctcccaaagcatggcatttgtaggtatgtggagggcctgtatctgc
caccacgttgacacctccagccaccagagagtttgccagcactacacctaccatgatggc
cttgttcctttggatattcgcttagcacaaaatctgctcctggttgcaaacattattggc
ctggttgggacagtttgtgctgtctttgctttacagcagttatacacagaggaactggag
aataatgatgacaacgacaatccatttgttctttcagccgttctcaacgctgttgctagc
acctttatttttcttgctgttatgtgtaattacttctctgagcccagcaaggaagggtta
tatttcctgccttcttcacaaatgccacttttcccatatgctcaaagagcaggaagtgcc
atgggaatggcaagcatatctgccatactgtttttattaagtgctataatttttatttct
tatagtccttcaatggaaaaagaaaaccttccacttgtctga

KEGG   Mus pahari (shrew mouse): 110320316
Entry
110320316         CDS       T05929                                 
Symbol
Cldn11
Name
(RefSeq) claudin-11
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110320316 (Cldn11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110320316 (Cldn11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110320316 (Cldn11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110320316 (Cldn11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110320316 (Cldn11)
   04147 Exosome [BR:mpah04147]
    110320316 (Cldn11)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110320316 (Cldn11)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110320316 (Cldn11)
  Exosomal proteins of colorectal cancer cells
   110320316 (Cldn11)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 110320316
NCBI-ProteinID: XP_021051911
Ensembl: MGP_PahariEiJ_G0026356
LinkDB
Position
4:25895876..25910370
AA seq 207 aa
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG
DAQSFGENRFYYSSGSSSPTHAKSAHV
NT seq 624 nt   +upstreamnt  +downstreamnt
atggtagccacttgcctgcaggtggtgggtttcgtcacgagcttcgtgggttggattggc
atcatcgtcacaacgtccaccaatgactgggtggtgacctgcagctacaccatccccacc
tgccgaaaaatggacgaactgggctccaaggggctgtgggccgactgcgtcatggccact
ggtctctaccactgcaaaccgctggtggacatcctcatccttccaggctacgtgcaggct
tgtagagccctcatgattgcggcttctgttctgggcctgccggccatcttgctgctgttg
acagttctcccctgcatccgaatgggccatgagcccggagtggccaagtacaggcgagct
cagctggctggggtgctccttattctgctggctctctgcgccattgtcgccaccatctgg
tttcctgtatgtgcccaccgcgagatcaccatcgtgagctttggctactccctgtacgcg
ggctggatcggtgctgtgatgtgcctggtgggtggctgtgtcatcgtctgctgctccggg
gatgcacagtcatttggagaaaaccgtttctattactcttctggttctagctcgccaacg
catgccaagagtgcccatgtctaa

KEGG   Mus pahari (shrew mouse): 110323517
Entry
110323517         CDS       T05929                                 
Symbol
Cldn19
Name
(RefSeq) claudin-19
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110323517 (Cldn19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110323517 (Cldn19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110323517 (Cldn19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110323517 (Cldn19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110323517 (Cldn19)
   04147 Exosome [BR:mpah04147]
    110323517 (Cldn19)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110323517 (Cldn19)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110323517 (Cldn19)
  Exosomal proteins of colorectal cancer cells
   110323517 (Cldn19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 110323517
NCBI-ProteinID: XP_021056442
Ensembl: MGP_PahariEiJ_G0028724
LinkDB
Position
6:70391588..70396057
AA seq 224 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVGMVLSVVGMKCTRVGDSNPIAKGRVAI
SGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGS
FLCCTCPEPERTNSIPQPYRSGPSTAAREPVVKLPASVKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctccagctcctgggctacttcctagccttgggcggctgggtgggc
atcatcgccagcactgccctgccacagtggaagcagtcctcctatgcaggcgatgccatc
atcactgccgtgggcctctacgaagggctgtggatgtcttgcgcctctcagagcaccggg
caggtgcagtgcaaactctacgattcactcctggccctggacggtcatatccagtcagca
cgagccctgatggttgtggctgtgctcctgggctttgtgggcatggtgctcagtgtcgtg
ggcatgaagtgcactcgggttggagacagcaaccccattgccaagggacgtgtggccatc
tccggaggtgctctcttcctcttggcgggtctctgtactttgactgctgtctcctggtac
gcaaccctggtgacccaggaattcttcaaccccagcactcctgtcaatgccaggtatgaa
tttggcccagctctgttcgtcggctgggcctcggctggcctggccatgctgggtggttcc
tttctctgctgcacatgcccagagccggagagaaccaacagcatcccacagccctatcgc
tctggaccctcaaccgctgcccgagaacctgttgttaagttgcccgcctcggtcaagggc
cccctgggtgtgtaa

KEGG   Mus pahari (shrew mouse): 110325649
Entry
110325649         CDS       T05929                                 
Symbol
Cldn10
Name
(RefSeq) claudin-10 isoform X1
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110325649 (Cldn10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110325649 (Cldn10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110325649 (Cldn10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110325649 (Cldn10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110325649 (Cldn10)
   04147 Exosome [BR:mpah04147]
    110325649 (Cldn10)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110325649 (Cldn10)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110325649 (Cldn10)
  Exosomal proteins of colorectal cancer cells
   110325649 (Cldn10)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 110325649
NCBI-ProteinID: XP_021059433
Ensembl: MGP_PahariEiJ_G0030612
LinkDB
Position
8:105893978..105974656
AA seq 287 aa
MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAAGSMASTA
LEIIAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKICVTDSTGVANCKE
FPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKTKIACLAGIVFI
LSGLCSMTGCSLYANKITTEFFDPLFMEQKYELGAALFIGWAGASLCIIGGVIFCFSISD
NNNKTPRMGYTYNGPTSVMSSRTKYQGGEGDFKTAGPSKQFDKNAYV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtccagggcgcagatctcagctctggtgtgtggtgttggaggctttggtgctctcgtt
gctgccaccacatccaacgaatggaaagtgaccactcgagcatcgtctgtgataactgcc
acctgggtttaccagggtctgtggatgaactgcgcagccggcagcatggctagcactgcc
ctggaaatcatcgccttcgtagtctccatctcgggctgggtgctagtgtcttccacgctg
cccaccgactactggaaggtctccaccatcgatggcactgtcatcaccaccgccacttat
tttgccaacctgtggaagatctgcgttaccgattccaccggtgtcgccaactgcaaggag
ttcccctccatgctggcgctggatggttacatccaggcatgtagaggactaatgatcgct
gcggtcagcctgggatttttcggttccatttttgcactctttggaatgaagtgtaccaaa
gttggaggctcagataaagccaaaactaaaattgcttgcttggctgggattgtattcata
ttgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaa
ttctttgatcctctctttatggagcaaaagtatgaattaggcgctgctctcttcatcgga
tgggcaggagcctctctctgcatcatcgggggagttatattttgcttttcaatatccgac
aacaacaacaagacgcccagaatgggctacacgtacaatggacccacatctgtcatgtct
tctcggaccaagtatcaaggcggagaaggagattttaaaaccgcaggcccttcaaaacag
tttgataaaaatgcctatgtctaa

KEGG   Mus pahari (shrew mouse): 110327149
Entry
110327149         CDS       T05929                                 
Symbol
Cldn25
Name
(RefSeq) putative claudin-25
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327149 (Cldn25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110327149 (Cldn25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110327149 (Cldn25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110327149 (Cldn25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110327149 (Cldn25)
   04147 Exosome [BR:mpah04147]
    110327149 (Cldn25)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110327149 (Cldn25)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110327149 (Cldn25)
  Exosomal proteins of colorectal cancer cells
   110327149 (Cldn25)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 110327149
NCBI-ProteinID: XP_021061532
LinkDB
Position
10:complement(44181952..44182644)
AA seq 230 aa
MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLNLDLNEMETWVSGLWEACVNQEEA
GTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSGCGLECFQFHRPGGVFKTRLCL
LGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGG
LLLIFSACLESEDGSSSWTAEATVPPACAPVEEEFDGSFHLTPRPVNQVI
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctgtagcttccgtgggagagtccagcttggaggtctgctcctctctgtccttggc
tgggtgtgctcctgtgtcaccaccgttcttccccagtggaagactctcaatctggatctg
aatgaaatggaaacctgggtctcgggactctgggaggcatgcgtgaatcaggaggaggct
ggcactgtatgcaaagccttcgagtcgtttttgtctctgccccaggagctacaggtagcc
cgaattctcatggtggcttcccatgggctgggactattgggacttctgctgtctggctgc
gggttggaatgcttccagtttcacaggcctggaggagttttcaagactcgactatgcctc
ctgggagggactctggaagcatcagcttcggccaccaccctgtttccagtctcctgggtg
gcctatgccacattccaagacttctgggatgacagcatccctgagattgtgccccggtgg
gagtttggagacgccttgttcctgggctgggctgctgggcttttcctagctgtgggtgga
ctcctcctcatcttttctgcttgcctggaaagtgaagatggatcttcttcctggacggct
gaagccacagtcccaccagcctgtgctccagtagaggaagaattcgatggttccttccac
ctcaccccaagaccggtgaaccaggtcatctag

KEGG   Mus pahari (shrew mouse): 110328136
Entry
110328136         CDS       T05929                                 
Symbol
Cldn18
Name
(RefSeq) claudin-18 isoform X1
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110328136 (Cldn18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110328136 (Cldn18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110328136 (Cldn18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110328136 (Cldn18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110328136 (Cldn18)
   04147 Exosome [BR:mpah04147]
    110328136 (Cldn18)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110328136 (Cldn18)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110328136 (Cldn18)
  Exosomal proteins of colorectal cancer cells
   110328136 (Cldn18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 110328136
NCBI-ProteinID: XP_021063162
Ensembl: MGP_PahariEiJ_G0015436
LinkDB
Position
10:complement(93031426..93058457)
AA seq 264 aa
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF
TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT
SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV
GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN
KKIYDGGARTEDDEQSHPTKYDYV
NT seq 795 nt   +upstreamnt  +downstreamnt
atggccaccaccacgtgccaggtggtggggcttctcctgtccctcctgggtctggccggc
tgcatagccgccactgggatggacatgtggagcactcaggacctgtatgataacccagtc
accgccgtgttccagtatgaagggctctggaggagttgcgtgcaacagagctcggggttc
accgagtgccggccatatttcaccatcctgggccttccagccatgctgcaagccgtacga
gccctgatgatcgtgggcattgttctgggggtcatcggtatcctcgtgtccatattcgcc
ctgaagtgcattcgcattggtagcatggatgactctgccaaggccaagatgactctgact
tctggaatcttgttcatcatctccggaatctgtgcaatcattggtgtgtctgtgtttgcc
aacatgctggtgaccaacttctggatgtccacagctaacatgtacagcggcatgggtggc
atgggtggcatggtgcagaccgttcagaccaggtacacctttggtgcagctctgttcgtg
ggctgggtcgctggaggcctcacactgattgggggagtgatgatgtgcatcgcctgccgt
ggcctgacaccagatgacagcaacttcaaagctgtgtcttaccatgcctctggccaaaat
gttgcctacaggcctggaggctttaaggccagcactggctttgggtccaacaccagaaac
aagaagatctacgatgggggtgcccgcacagaagatgacgaacaatctcatcctaccaag
tatgactatgtgtag

KEGG   Mus pahari (shrew mouse): 110329625
Entry
110329625         CDS       T05929                                 
Symbol
Cldn1
Name
(RefSeq) claudin-1
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329625 (Cldn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329625 (Cldn1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110329625 (Cldn1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329625 (Cldn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110329625 (Cldn1)
   04147 Exosome [BR:mpah04147]
    110329625 (Cldn1)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110329625 (Cldn1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110329625 (Cldn1)
  Exosomal proteins of colorectal cancer cells
   110329625 (Cldn1)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Voltage_CLC CD20 Amastin DUF6336 DUF4134
Other DBs
NCBI-GeneID: 110329625
NCBI-ProteinID: XP_021065033
Ensembl: MGP_PahariEiJ_G0016332
LinkDB
Position
12:complement(21638701..21654426)
AA seq 211 aa
MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV
IGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGA
LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctactgggtttcatcctggcttccctgggatggatcggc
tccatcgtcagcactgccctgccccagtggaagatttactcctatgctggggacaacatc
gtgaccgctcaggccatctacgagggactgtggatgtcctgcgtttcgcaaagcaccggg
cagatacagtgcaaagtctttgactccttgctgaatctgaacagtactttgcaggcaacc
cgagccttgatggtaattggcatcctgctggggctgatcgcaatctttgtgtccaccatt
ggcatgaagtgcatgaggtgcctggaagatgatgaggtgcagaagatgtggatggctgtc
attgggggcataatatttttaatttcaggtctggcgacattagtggccacagcatggtat
ggaaacagaattgttcaagagttctacgaccccttgacccccatcaatgccaggtatgaa
tttggccaggccctctttactggctgggccgctgcctccctctgcctcctgggaggtgcc
ctactttcctgctcctgtccccggaaaacaacctcttacccaacaccacggccttatccc
aagccaacaccttctagtgggaaagattatgtgtga

KEGG   Mus pahari (shrew mouse): 110329722
Entry
110329722         CDS       T05929                                 
Symbol
Cldn5
Name
(RefSeq) claudin-5
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329722 (Cldn5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329722 (Cldn5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110329722 (Cldn5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329722 (Cldn5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110329722 (Cldn5)
   04147 Exosome [BR:mpah04147]
    110329722 (Cldn5)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110329722 (Cldn5)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110329722 (Cldn5)
  Exosomal proteins of colorectal cancer cells
   110329722 (Cldn5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 110329722
NCBI-ProteinID: XP_021065203
Ensembl: MGP_PahariEiJ_G0016257
LinkDB
Position
12:14530179..14531645
AA seq 218 aa
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG
HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALT
GGALYALCGLLALVPLCWFANIVVREFYDPAVPVSQKYELGAALYIGWAASALLMCGGGL
VCCGAWVCSGRPEFSFPVKYSAPRRSTANGDYDKKNYV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggtctgcggcgttggaaattctgggtctggtgctgtgtctggtaggatgggtgggc
ttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaacatc
gtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagtaccggg
catatgcagtgcaaggtgtatgagtctgtgctggcgctgagtgcagaggtgcaggcagct
cgggcactcaccgtgggcgctgtgcttctggcgctggtggcactctttgttaccttgacc
ggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtggcactcacg
ggaggagcgctttacgcgctgtgcgggctgctagcactggtgccgctctgctggttcgcc
aacatcgtagtccgcgagttctatgatccggcggtgcccgtgtcacagaagtacgagctg
ggcgcggcgctgtacatcggttgggcggcctccgcactgctcatgtgcggtggcggcctc
gtgtgctgcggtgcctgggtctgctccgggcgcccagagttcagcttcccggtcaagtac
tccgcgccgcggcggtccacggccaatggcgattacgacaagaagaactacgtctaa

KEGG   Mus pahari (shrew mouse): 110329976
Entry
110329976         CDS       T05929                                 
Symbol
Cldn16
Name
(RefSeq) claudin-16
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329976 (Cldn16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329976 (Cldn16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110329976 (Cldn16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329976 (Cldn16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110329976 (Cldn16)
   04147 Exosome [BR:mpah04147]
    110329976 (Cldn16)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110329976 (Cldn16)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110329976 (Cldn16)
  Exosomal proteins of colorectal cancer cells
   110329976 (Cldn16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF1118 DuoxA
Other DBs
NCBI-GeneID: 110329976
NCBI-ProteinID: XP_021065578
Ensembl: MGP_PahariEiJ_G0016333
LinkDB
Position
12:21747188..21767291
AA seq 235 aa
MKDLLQYAACFLATFSTGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT
CDEYDSIYAEHPLKLVVTRALMITADILAGFGFITLLLGLDCVKFLPDEPHVKVRLCFVA
GTTLLIAGTPGIIGSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAG
ALLTCCLYLFKDVGPERNYPYATRKRYSTAGVSMAKSYKAPRTETAKMYAVDTRV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaggatcttcttcagtatgctgcctgcttcttggccacattttccactgggtttttg
atcgtggccacgtggacagactgttggatggtgaacgctgatgactccctggaggtgagc
actaaatgcagaggcctgtggtgggagtgcgtaacaaacgcttttgatgggattcgaacc
tgcgatgagtacgactccatatatgcagaacaccccttgaagctggtggtgacccgagca
ctgatgatcacagctgacattctagctggctttgggttcatcactctgctccttggtctt
gactgtgtgaagttcctacccgatgagccacacgttaaagtccgcctctgctttgttgca
gggaccacattactcattgcaggtaccccgggaatcattggctctgtgtggtatgctgtg
gatgtttacgtcgaacgctcctctctcgttttacacaatatatttcttgggatccaatat
aaatttggttggtcctgctggcttggaatggctgggtctttgggttgctttttagcagga
gctctccttacctgctgtttgtacctcttcaaagatgttgggcctgagaggaactaccct
tatgccacgaggaagcgttattcaactgcaggtgtgtccatggctaagtcctacaaggct
cctcggacggagacagccaaaatgtatgctgtagacaccagagtataa

KEGG   Mus pahari (shrew mouse): 110330072
Entry
110330072         CDS       T05929                                 
Symbol
Cldn8
Name
(RefSeq) claudin-8
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110330072 (Cldn8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110330072 (Cldn8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110330072 (Cldn8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330072 (Cldn8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110330072 (Cldn8)
   04147 Exosome [BR:mpah04147]
    110330072 (Cldn8)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110330072 (Cldn8)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110330072 (Cldn8)
  Exosomal proteins of colorectal cancer cells
   110330072 (Cldn8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DUF6338
Other DBs
NCBI-GeneID: 110330072
NCBI-ProteinID: XP_021065674
Ensembl: MGP_PahariEiJ_G0016609
LinkDB
Position
12:complement(79756176..79758515)
AA seq 225 aa
MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANI
RMQCKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILL
TAGITFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGA
LFCCVFCCTERSNSYRYSVPSHRTTQRSFHAEKRSPSIYSKSQYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcaacctatgctcttcaaatggctgcactggtgcttggtggtgttggcatggtgggc
acggtggctgtgactatcatgcctcagtggagagtgtctgccttcatcgaaagtaacatc
gtggtgtttgagaaccgctgggaaggcttgtggatgaactgcatgagacatgccaacatc
agaatgcagtgcaaggtctacgactccctgctggctcttagtccagacctgcaggcatcc
agaggactgatgtgcgctgcgtccgtcttggctttcttggctttcatgacagccatcctc
ggaatgaagtgcaccaggtgcacgggggacgatgagaacgtgaagagccgcatcttgttg
acagcgggaatcaccttcttcatcaccggcttggttgtgctcatccctgtcagctgggtt
gccaattccatcatcagagacttctacaacccgttggtggatgtggccctaaagcgcgag
ctgggagaagccctctacataggctggaccacagcgctggtgctgattgccggaggagca
ctgttctgttgtgtgttttgttgtactgaaaggagcaacagttacaggtactccgtacca
tcccatcgcaccactcaacggagtttccatgctgaaaagagatctccgagcatatactcc
aaaagtcagtatgtgtag

KEGG   Mus pahari (shrew mouse): 110330109
Entry
110330109         CDS       T05929                                 
Symbol
Cldn14
Name
(RefSeq) claudin-14
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110330109 (Cldn14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110330109 (Cldn14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110330109 (Cldn14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330109 (Cldn14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110330109 (Cldn14)
   04147 Exosome [BR:mpah04147]
    110330109 (Cldn14)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110330109 (Cldn14)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110330109 (Cldn14)
  Exosomal proteins of colorectal cancer cells
   110330109 (Cldn14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin DGF-1_C YtpI Laminin_EGF Colicin_V
Other DBs
NCBI-GeneID: 110330109
NCBI-ProteinID: XP_021065724
Ensembl: MGP_PahariEiJ_G0016690
LinkDB
Position
12:complement(84978473..84988588)
AA seq 239 aa
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVL
GGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtggga
acgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggtaccaacatc
ctgacggccgtgtcctacctgaagggactgtggatggagtgcgtgtggcacagcacaggc
atctaccagtgtcagatctaccgctcgctgctggcgctgcctcgggacctgcaggcagcc
cgggcactcatggtcatctcctgcctgctgtccggcatggcctgcgcctgcgcagtagtg
ggcatgaagtgcacacgctgcgccaagggcacacccgccaagaccaccttcgcagtgctg
gggggcgcgctcttcctgctggccggcctgctgtgcatggtggctgtgtcctggaccacg
aacgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgagatc
ggccaggccctgtacctgggcttcatctcctcgtccctgtctctcatcgggggcaccctg
ctctgcttatcctgccaggacgaggccccctacagaccctaccctccacagtccagagct
ggtgccaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaac
cgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtga

KEGG   Mus pahari (shrew mouse): 110330140
Entry
110330140         CDS       T05929                                 
Symbol
Cldn17
Name
(RefSeq) claudin-17
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110330140 (Cldn17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110330140 (Cldn17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110330140 (Cldn17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330140 (Cldn17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110330140 (Cldn17)
   04147 Exosome [BR:mpah04147]
    110330140 (Cldn17)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110330140 (Cldn17)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110330140 (Cldn17)
  Exosomal proteins of colorectal cancer cells
   110330140 (Cldn17)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 DUF4064
Other DBs
NCBI-GeneID: 110330140
NCBI-ProteinID: XP_021065759
Ensembl: MGP_PahariEiJ_G0016608
LinkDB
Position
12:complement(79712208..79713359)
AA seq 224 aa
MAFYPLQIAGLVLGFFGLVGTIGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMV
TLQCKFYNSILALPPVLEAARALMCVAVALALVALIIGICGMKQLQCTGSSERVKAYLLG
TSGVLFILTGIFVLIPVSWTANIIIRDFYDPTVHAGQKRELGGALFLGWATAAVLFTGGG
LLCGYCCCNRKERWHRYPVPAYRVPQKDNQRNVTVPRKSSTSYV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggctttttatcccttacagatcgctggactagttcttggattcttcggtttggttggg
acgattgggacaacacttctgcctcaatggagagtgtcagctttcatcggcagcaacatt
attatctttgagaggatctgggaaggcctttggatgaactgcatccagcaagctatggtc
acgctgcagtgcaaattctataactctatattggctctccctccggtactggaagcagcg
cgtgcactcatgtgtgtggctgtggctcttgccttggttgctctcattattggcatctgc
ggcatgaaacagctccagtgcaccggctccagcgagagggtcaaagcctacttgctggga
acctcaggggtgctctttattctgacgggtatcttcgttctgattccagtgtcctggact
gccaatatcatcatcagagatttctacgacccaaccgtccatgcagggcagaagcgagaa
cttggaggagcactcttccttggctgggcaaccgctgctgtcctcttcactggaggcggg
ctgctctgtggatactgctgctgcaacagaaaggaacggtggcacagatacccagtccct
gcatatcgcgtgccacagaaggataaccaaaggaatgttactgtgcctagaaaatcttcc
accagctacgtctaa

KEGG   Mus pahari (shrew mouse): 110332203
Entry
110332203         CDS       T05929                                 
Symbol
Cldn7
Name
(RefSeq) claudin-7
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110332203 (Cldn7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110332203 (Cldn7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110332203 (Cldn7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110332203 (Cldn7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110332203 (Cldn7)
   04147 Exosome [BR:mpah04147]
    110332203 (Cldn7)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110332203 (Cldn7)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110332203 (Cldn7)
  Exosomal proteins of colorectal cancer cells
   110332203 (Cldn7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 FtsX SUR7 Amastin Clc-like
Other DBs
NCBI-GeneID: 110332203
NCBI-ProteinID: XP_021068953
Ensembl: MGP_PahariEiJ_G0017739
LinkDB
Position
14:37807657..37810152
AA seq 211 aa
MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTG
MMSCKMYDSVLALPGALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKAKKARIAM
TGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVILGGA
LLSCSCPGSESKAAYRAPRSYPKSNSSKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctaactcgggcctgcaactgctgggcttttcaatggccatgcttggctgggtgggc
ctgatagcgagcactgccatcccgcagtggcagatgagctcctatgcgggcgacaacatc
atcacagcccaggccatgtacaaggggctctggatggagtgcgtcacgcagagcaccggc
atgatgagctgcaaaatgtacgactcggtgctcgccctaccgggggccctgcaggccact
cgagccttaatggtggtgtccctggtgttgggcttcttggccatgtttgtcgccacgatg
ggcatgaagtgcacacgctgtgggggagatgacaaagcgaagaaggcacgtatagctatg
actggaggcattattttcatcgtggcaggtcttgccgccttggtagcatgttcctggatt
ggtcatcagattgtcacagacttttataaccccttgacgcccatgaacattaagtatgag
ttcgggcctgccatctttatcggctgggcagggtctgctctggtcattctgggaggtgcc
ctgctctcttgctcctgtccaggcagtgagagcaaagctgcctaccgagcaccccgatcc
taccccaagtccaattcctccaaggaatatgtgtga

KEGG   Mus pahari (shrew mouse): 110337052
Entry
110337052         CDS       T05929                                 
Symbol
Cldn23
Name
(RefSeq) claudin-23
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337052 (Cldn23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110337052 (Cldn23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110337052 (Cldn23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110337052 (Cldn23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110337052 (Cldn23)
   04147 Exosome [BR:mpah04147]
    110337052 (Cldn23)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110337052 (Cldn23)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110337052 (Cldn23)
  Exosomal proteins of colorectal cancer cells
   110337052 (Cldn23)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Yip1 Trp_oprn_chp TMEM_230_134
Other DBs
NCBI-GeneID: 110337052
NCBI-ProteinID: XP_021075453
Ensembl: MGP_PahariEiJ_G0021450
LinkDB
Position
19:complement(52918766..52920588)
AA seq 295 aa
MRTPVVMTLGMVLTPCGLLLNLVSTLAPGWRLVKGFRDQPVDVVLYQGLWDICREQSSRE
RECGQPDEENYFQTQPVQVARGLMITSLATTALGLLLASLGVRCWQDEPHYGLAGLSGVV
LFAAGLFSLIPVSWYNHFLSDPTVLAAPSSPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
FAPWCEERCRHCRKAPPAGPRRSSISTVYVDWPEPALTPAIKYYSDGQHRPPPAERRDTG
KLKVGFPMPRPPPKAYTNPMDVLQGEEKKTATSQGGSSSRSTRPCQNSLPCDSDL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgctcacaccctgcgggttactgctc
aatctcgtcagtacactggccccgggctggcggctggtgaagggctttcgggatcagcca
gtggacgtggtgctgtaccaggggctgtgggacatatgtcgcgagcagagcagtcgcgag
cgcgagtgcggccagccggacgaggagaactacttccagacccagcctgtgcaagtggcc
cggggactcatgatcacgtcactggccactaccgccctagggctgctgttggcttcgctc
ggcgtgcgttgttggcaagatgagccccactacgggctagccgggctctccggcgtggtg
cttttcgccgctggcctcttcagcctcatcccggtctcctggtataaccacttcttgtca
gatcccaccgtcctggccgccccgagctcgccggtcaccgtgcaggtcagctacagcctg
gtgctaggttacctcggcagctgcctgttgcttctgggcggcttctcgctggcgctcagc
tttgcgccctggtgtgaagagcgttgtcgccactgtcgcaaggcgcccccagcaggcccg
cgccgcagcagcatcagcaccgtctacgtggactggccggaacccgcgcttacacctgcc
atcaagtactacagcgacgggcagcatcggcctcctcccgcggagcgcagggacactggc
aagctcaaggtgggattcccgatgccacgaccgccacccaaggcctacaccaacccgatg
gatgtgcttcagggggaagaaaagaagacagccacctcccaaggtggttcctcctctcgc
agcactcggccctgccaaaattcgctgccctgtgactctgacctgtag

KEGG   Mus pahari (shrew mouse): 110337128
Entry
110337128         CDS       T05929                                 
Name
(RefSeq) claudin-22
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337128
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110337128
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110337128
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110337128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110337128
   04147 Exosome [BR:mpah04147]
    110337128
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110337128
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110337128
  Exosomal proteins of colorectal cancer cells
   110337128
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 110337128
NCBI-ProteinID: XP_021075542
LinkDB
Position
19:63964997..63967980
AA seq 222 aa
MAFIFRKAMQSVGLSLSLLGWVLAVITTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEV
GRQCKDFDSFLALPAELQVSRVLMSLCXGLGLLGLLASGCGLDCLRLGETQEGLKKRLLT
LGGILLWTSGVTVLVPVSWVAHTTVQEFWDETMPEIVPRWEFGEALFLGWFAGFCLVXGG
CVLHCAACSRPAPAASASGHYAVAGPRDHQQHLELKQANPEI
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctttcatcttcagaaaggccatgcaatcggtagggctttccctgtcattgctggga
tgggttttagccgttattaccacgtatctaccacattggaagaaccttaacctggaactg
aacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtc
gggaggcaatgcaaggactttgactccttcctggccttgccagcagaactgcaggtctcc
agggtcttgatgtccctgtgcaanggactggggctgctgggcttgctggcctctggctgt
ggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcgactgctcacc
ctgggagggatcctgctctggacctcgggggtcacggtgctggttcctgtctcctgggtg
gcccacacgacggtgcaggagttctgggatgagaccatgcctgagattgtacccaggtgg
gagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgntaggaggg
tgtgtgcttcactgtgcagcctgctcgagaccagctcctgcagcctcggcctcgggtcac
tatgcagtggcaggacctcgagaccaccagcagcacctggagctgaaacaagccaatcca
gaaatctaa

KEGG   Mus pahari (shrew mouse): 110338212
Entry
110338212         CDS       T05929                                 
Symbol
Cldn20
Name
(RefSeq) claudin-20
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110338212 (Cldn20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110338212 (Cldn20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110338212 (Cldn20)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110338212 (Cldn20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110338212 (Cldn20)
   04147 Exosome [BR:mpah04147]
    110338212 (Cldn20)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110338212 (Cldn20)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110338212 (Cldn20)
  Exosomal proteins of colorectal cancer cells
   110338212 (Cldn20)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 110338212
NCBI-ProteinID: XP_021077145
Ensembl: MGP_PahariEiJ_G0023337
LinkDB
Position
21:421183..421943
AA seq 219 aa
MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNAYAGSNIVTAIVQVHGLWMDCTWYSTG
MFSCTLKYSILSLPVHVQTARATMVLACVLSALGICTSIVGMKCTHLGGDTHTKRQISFA
GGVCFITAGISGLIPTVWYTKEIIANFLDLTIPESHKYEPGGALYIGFISVMLLLTSGII
LCISYMKKNREPWIYPPKPKLTSTWQPKNRLAYNLKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcctccgccggtctccagctccttgctttcatcctggccgtgtctggggtgtctgga
gtacttgctgccactctgctgccaaactggaaggttaatgcatatgcaggctccaacatt
gtaactgctattgtgcaggtgcatgggctgtggatggactgcacgtggtacagcactggg
atgtttagctgcactttgaaatactccattctgtcactccccgtccatgtgcagactgcg
agggccaccatggtcctggcctgtgttctgtctgctttggggatttgtacttcgatagta
ggaatgaaatgcactcacttaggaggagacacacacaccaaacgtcaaatttcctttgct
ggaggagtctgcttcattactgcagggatctctggtttaatcccaacagtgtggtacacc
aaggagatcatagcgaactttttggatctgaccattccggaaagccacaaatatgagcct
ggaggagctctgtacatcgggttcatttccgtgatgctactgcttacctctggtattatt
ctctgcatttcctatatgaaaaagaaccgagaaccatggatctatcctcccaagccgaaa
cttacctcgacctggcagccaaagaacaggctagcatataacctgaaggattacgtgtaa

KEGG   Mus pahari (shrew mouse): 110338251
Entry
110338251         CDS       T05929                                 
Symbol
Cldn6
Name
(RefSeq) claudin-6
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110338251 (Cldn6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110338251 (Cldn6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110338251 (Cldn6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110338251 (Cldn6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110338251 (Cldn6)
   04147 Exosome [BR:mpah04147]
    110338251 (Cldn6)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110338251 (Cldn6)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110338251 (Cldn6)
  Exosomal proteins of colorectal cancer cells
   110338251 (Cldn6)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 GPDPase_memb Clc-like
Other DBs
NCBI-GeneID: 110338251
NCBI-ProteinID: XP_021077196
Ensembl: MGP_PahariEiJ_G0023470
LinkDB
Position
21:18665596..18666392
AA seq 219 aa
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDKNSKSRLVLI
SGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAAAGLLLLGGGL
LCCACSSGGPQGPGHYMARYSTSVPHSRGPSEYPTKNYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcctctactggtttgcaaatcttggggatcgtcctgaccctgcttggctgggtcaac
gccctggtgtcctgtgccctgcccatgtggaaggtgaccgccttcatcggcaacagcatc
gtcgtggcccagatggtgtgggaggggctgtggatgtcctgtgtggtgcagagcactggc
cagatgcagtgcaaggtgtatgactcactgctggcgctgccccaggacctgcaggctgcc
agagccctctgcgttgtcaccctcctcattgtcctgcttggcctactcgtgtacctggcc
ggagccaagtgcactacctgtgtggaagacaagaactccaagtctcgtctggtgctcatc
tctggcatcatcttcgtcatctctggggtcctgaccctcattcctgtctgctggactgcc
cactctatcatccaggacttctacaaccccttggtggctgatgctcaaaagcgggagctg
ggggcctccctctacctgggctgggcagccgcgggccttttgctgctaggtggagggcta
ctatgctgcgcctgctcttctggaggcccccagggacctggccattacatggcccgctat
tctacatctgtcccacattctcggggaccctccgaataccccaccaagaattatgtctga

KEGG   Mus pahari (shrew mouse): 110338269
Entry
110338269         CDS       T05929                                 
Symbol
Cldn9
Name
(RefSeq) claudin-9
  KO
K06087  claudin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110338269 (Cldn9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110338269 (Cldn9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110338269 (Cldn9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110338269 (Cldn9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mpah03037]
    110338269 (Cldn9)
   04147 Exosome [BR:mpah04147]
    110338269 (Cldn9)
Cilium and associated proteins [BR:mpah03037]
 Other cilia and associated proteins
  Stereociliary proteins
   110338269 (Cldn9)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   110338269 (Cldn9)
  Exosomal proteins of colorectal cancer cells
   110338269 (Cldn9)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM_230_134
Other DBs
NCBI-GeneID: 110338269
NCBI-ProteinID: XP_021077218
Ensembl: MGP_PahariEiJ_G0023471
LinkDB
Position
21:complement(18667114..18668561)
AA seq 217 aa
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcttctactggccttgaactccttggcatgaccctggctgtgctaggctggctagga
accctggtgtcctgtgccctgccactgtggaaggtgaccgccttcatcggcaacagcatc
gtagtggcccaagtggtatgggaggggctgtggatgtcttgtgtggtccagagcactggc
cagatgcagtgcaaagtatacgactcactgctggcgctgccccaggacctgcaggcagcc
agagccctctgtgtcgtggccctccttctggctttgctgggcctgctggtggctatcacg
ggcgcccagtgcaccacgtgtgtggaggacgaaggtgccaaggcacggatcgtactcacc
gcaggggtcctcctcctcctctccggcatcctggtgcttatccctgtctgctggacagcc
catgccatcatccaggatttttataacccactggttgctgaagccctcaagagagaactg
ggggcttccctctacctgggctgggctgccgctgcactgctcatgctagggggagggctc
ctctgctgtacgtgtcccccgtcacactttgagcgtccccgcggccccaggctgggctac
tccatcccttcccgttcgggtgcttcgggactggataagagggactatgtgtga

DBGET integrated database retrieval system