KEGG   Mus pahari (shrew mouse): 110313068
Entry
110313068         CDS       T05929                                 
Symbol
Serpine1
Name
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04066  HIF-1 signaling pathway
mpah04115  p53 signaling pathway
mpah04218  Cellular senescence
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
mpah04610  Complement and coagulation cascades
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110313068 (Serpine1)
   04371 Apelin signaling pathway
    110313068 (Serpine1)
   04066 HIF-1 signaling pathway
    110313068 (Serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110313068 (Serpine1)
   04218 Cellular senescence
    110313068 (Serpine1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110313068 (Serpine1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110313068 (Serpine1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110313068 (Serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110313068 (Serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110313068 (Serpine1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110313068 (Serpine1)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110313068 (Serpine1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110313068 (Serpine1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110313068 (Serpine1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 110313068
NCBI-ProteinID: XP_021042757
Ensembl: MGP_PahariEiJ_G0024450
LinkDB
Position
23:complement(27241301..27250359)
AA seq 402 aa
MQMSSALACLTLGLVLVSGKGFALPLRESHTAHQATDFGVKVFQQVVQASRDRNVIFSPY
GVSSVLTMLQLTTAGKTRQQIQDAMGFKINEKGTAHALRQLSKELMGPWNKNEISTADAI
FVQRDLELVQGFMPHFFKLFQTTVKQVNFSEVESARFIINDWVEKHTKGMISDLLAKGAI
DELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTISVPMMVQSNKFNYTEFTTPD
GLEYDVVELPYQGETLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLILPK
FSLETEVDLRGPLERLGMTDMFSATQADFTSLSDQEQLSVAQALQKVRIEVTESGTVASS
STAFVISARMAPTEMVIDRSFLFVVRHNPTETILLMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtcttcagccctcgcttgcctcaccctgggcctggttctggtctctgggaaa
gggttcgctttacccctccgagaatcccacacagcccatcaggccaccgactttggagta
aaagtgtttcagcaggtggtccaggcctcccgagaccggaatgtgatcttctctccctat
ggcgtgtcctcggtgctgactatgctgcagctgaccacagcggggaaaacccggcagcag
atccaagatgccatggggttcaaaatcaatgagaagggcacagctcatgccctccgccag
ctctccaaggagctcatggggccatggaacaaaaatgagatcagtactgcggacgccatc
tttgtccagcgggacctggagctggtccagggcttcatgcctcacttcttcaagctcttc
cagactacggtgaaacaggtgaacttctcagaggtggaaagtgccagattcatcatcaat
gactgggtggaaaagcacaccaaaggtatgatcagtgacttactggccaagggggctata
gacgagctgacacgcctggtgctggtgaacgccctctacttcagtggccaatggaagacc
cctttcttagaggccagcacccaccagcgcctcttccacaagtctgatggcagcaccatc
tctgtgcccatgatggtgcagagcaacaagttcaactacactgagttcaccaccccggat
gggctcgagtatgacgtcgtggaactgccctaccagggcgaaaccctcagcatgttcatc
gccgccccctttgagaaagatgtccacctctcggccctcaccaatatcttggatgctgaa
ctcatcagacaatggaagggcaacatgaccaggctgccccgcctcctcatcctgccaaag
ttctctctggagacggaagtggacctcagagggcccctggagaggttgggcatgactgac
atgtttagcgcaacccaggccgacttcacaagcctttccgaccaagagcagctctctgtt
gcacaggcgctgcaaaaggtcaggatcgaggtgaccgagagcggcacagtggcgtcttcc
tccacagcctttgtcatctccgcccgcatggcccccacggagatggttatagaccgatcc
tttctctttgtggttcggcacaatccgacagagacaatcctcttaatgggccaggtgatg
gagccttga

KEGG   Mus pahari (shrew mouse): 110322355
Entry
110322355         CDS       T05929                                 
Symbol
Serpinb2
Name
(RefSeq) plasminogen activator inhibitor 2
  KO
K19821  plasminogen activator inhibitor 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322355 (Serpinb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110322355 (Serpinb2)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110322355 (Serpinb2)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 110322355
NCBI-ProteinID: XP_021054655
Ensembl: MGP_PahariEiJ_G0027734
LinkDB
Position
5:83479530..83493952
AA seq 415 aa
MEELSMANTVFALNLFKQIEKSNSTQNIFISPWSISSTLAIVFLGAGANTEQQMAKVLQF
NKIGSYGITPGNPENFSGCDFAQEIQKDNYPSAVLQAQARDKIHSAFSSLSSTINTPQGD
YLLESANKLFGEKSARFKEEYIQRSKKYYSTEPEAVDFLECAEEARKKINSWVKTQTKGE
IPNLLPEGSVDEDTKMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSHESIPVQMMFLREK
LNIGYIKDLKTQILELPYIGNISMFLLLPDKIEDASTGLELLESKINFANFNKWISKDTL
DEDDVVVYIPKFKLTQSYELKSILQSMGMEDAFNKSKANFSGMSERNDLFLSEVFHQASV
DVTEEGTVAAGGTGAVMTGRTGHGGPQFVADHPFLFFIMDKITHTILFVGRFSSP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggaagaactttccatggcaaacaccgtatttgccctcaatctctttaagcagatagaa
aaatcaaactctacccagaacatctttatctctccgtggagcatctcatcaacattggcc
attgttttcctcggtgctggggctaacacagaacagcagatggccaaagtgctgcagttt
aacaaaattggcagctatggcatcaccccaggaaacccagagaacttcagtggctgtgat
ttcgcacaagagatacagaaagacaattatcctagtgctgttttacaggcacaagcaaga
gataaaatccattcagccttctcctctctcagctcaacaatcaacacaccacagggagat
tatttattagaaagtgcaaacaagctgtttggagagaagtctgcaagattcaaagaagaa
tatatccaacgctctaagaaatactactccacagaaccagaagcagtagacttccttgaa
tgtgctgaagaagctaggaaaaagattaattcttgggtcaagactcaaaccaaaggtgaa
atcccaaaccttctacctgaaggatctgtagatgaagacaccaagatggtgctggtgaat
gctgtctacttcaaaggaaagtggaaaactccatttgagaagaaacttaatgggctttat
cctttccgtgtgaactcgcatgagagcattcctgtccagatgatgttccttcgcgaaaaa
ctgaacattggatacataaaggacctgaagactcagatcctagaactcccgtatattgga
aacatcagcatgttcctgttacttcctgataagattgaagatgcgtccactggcttggaa
ttgctggaaagtaaaataaactttgctaacttcaacaagtggatcagcaaagacacactg
gatgaagatgatgttgtggtctacattcccaagttcaaactgacacaaagctatgaactc
aagtccattcttcaaagcatgggcatggaggatgccttcaacaagagcaaggccaacttc
tcaggaatgtctgagaggaatgacctttttctttctgaggtgttccatcaagccagtgta
gatgtcactgaggagggcactgtggcagctggtgggactggggcagttatgacagggaga
actggccatggtggcccacagtttgtggccgatcatccctttcttttctttatcatggac
aaaattacccacacaatactatttgttggtagattctcctcaccctaa

DBGET integrated database retrieval system