KEGG   Mus pahari (shrew mouse): 110313411
Entry
110313411         CDS       T05929                                 

Gene name
Tcf7l2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05132  Salmonella infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110313411 (Tcf7l2)
   04390 Hippo signaling pathway
    110313411 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110313411 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110313411 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110313411 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110313411 (Tcf7l2)
   05225 Hepatocellular carcinoma
    110313411 (Tcf7l2)
   05226 Gastric cancer
    110313411 (Tcf7l2)
   05216 Thyroid cancer
    110313411 (Tcf7l2)
   05221 Acute myeloid leukemia
    110313411 (Tcf7l2)
   05217 Basal cell carcinoma
    110313411 (Tcf7l2)
   05215 Prostate cancer
    110313411 (Tcf7l2)
   05213 Endometrial cancer
    110313411 (Tcf7l2)
   05224 Breast cancer
    110313411 (Tcf7l2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110313411 (Tcf7l2)
   05165 Human papillomavirus infection
    110313411 (Tcf7l2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110313411 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110313411 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110313411 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110313411 (Tcf7l2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110313411 (Tcf7l2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110313411
NCBI-ProteinID: XP_021043247
Ensembl: MGP_PahariEiJ_G0014574
LinkDB
Position
1
AA seq 621 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGSLQSRQTLKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPC
RRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPHLLGSPPQDAKSQTEQTQPLSLSLKP
DPLAHLSMMPPPPALLLAEAAHSKASALCPNGALDLPPAALQPSMVPSSSLAQPSTSSLH
SHNSLAGTQPQPLSLVTKSLE
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgctaacgacgagctgatctcc
ttcaaagacgaaggcgagcaggaggagaagaactcggaaaactcctcggcggagagggat
ttagccgatgtcaagtcctcgctggtcaatgaatcagagacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcaatccggcagcactcattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgat
gtccaagcaggaagcctccagagcagacaaaccctcaaggatgctcgttcaccgtcgcca
gcacacatcgtttcgaacaaagtaccggtggtgcaacacccccaccatgtccacccactc
acgcctctcatcacgtacagcaatgaacacttcaccccgggaaatccacctccacactta
ccagctgacgtagaccccaaaacaggaatcccaaggcctccgcaccctccagatatctct
ccatattacccgctgtcgcccggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcagcctgtgtacccaatcacgacaggaggattcagacacccctac
cccacagcgctgacagttaacgcatctatgtctaggttccctccccatatggtccctccc
catcacactctgcacacgaccggcatccctcacccggccatcgtcacaccaacagtcaag
caggaatcctcccagagtgacgtcggctcactgcacagctcaaagcatcaggactccaaa
aaggaagaagagaagaagaagccccacataaagaagccacttaatgcattcatgttgtat
atgaaggagatgagagcaaaggtggtggccgaatgcacactgaaagagagtgcagccatc
aaccagattctcgggcgcaggtggcacgccctgtccagggaagaacaggcaaagtactac
gagctggcccggaaggaacgacagcttcacatgcagctgtaccctggctggtctgcacgg
gataactatgggaagaagaagaagagaaaaagagacaagcagccgggggaaaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcgcttcctccgatcacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccctgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagcccaccc
tcttcagatggaagcttactagactcgcctcccccctcaccgcatctgctaggctcccct
ccccaagacgccaagtcacagactgagcagacgcagccgctctcgctgtccctgaagcct
gatcctttggcccacctgtccatgatgcctccgccacccgcgctcctgctggccgaagct
gcccacagcaaggcctctgccctctgtcccaacggggctctggacctgccacctgccgct
ctgcagccgtccatggtcccttcctcatcgctcgcacaaccatcaacttcttccttacat
tcccacaactcgctggctggaacgcaaccccagcctctgtctctggtgaccaagtcttta
gaatag

KEGG   Mus pahari (shrew mouse): 110315696
Entry
110315696         CDS       T05929                                 

Gene name
Tcf7l1
Definition
(RefSeq) transcription factor 7-like 1 isoform X1
  KO
K04490  transcription factor 7-like 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05132  Salmonella infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110315696 (Tcf7l1)
   04390 Hippo signaling pathway
    110315696 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110315696 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110315696 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110315696 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110315696 (Tcf7l1)
   05225 Hepatocellular carcinoma
    110315696 (Tcf7l1)
   05226 Gastric cancer
    110315696 (Tcf7l1)
   05216 Thyroid cancer
    110315696 (Tcf7l1)
   05221 Acute myeloid leukemia
    110315696 (Tcf7l1)
   05217 Basal cell carcinoma
    110315696 (Tcf7l1)
   05215 Prostate cancer
    110315696 (Tcf7l1)
   05213 Endometrial cancer
    110315696 (Tcf7l1)
   05224 Breast cancer
    110315696 (Tcf7l1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315696 (Tcf7l1)
   05165 Human papillomavirus infection
    110315696 (Tcf7l1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110315696 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110315696 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110315696 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110315696 (Tcf7l1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110315696 (Tcf7l1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110315696
NCBI-ProteinID: XP_021045352
Ensembl: MGP_PahariEiJ_G0022246
LinkDB
Position
2
AA seq 599 aa
MPQLGGGRGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSASVKDTRSPSPAHLYGDPARW
MVPPTFRSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPS
ELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRF
PHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKP
LNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQL
YPTWSARDNYGKKKKRKREKQLSQTQSQPQIQEAEGALASKSKKPCIQYLPPEKPCDSPA
SSHGSTLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAA
SNSSQMGSQPPLLSRPLPLGSMPAALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgccccagctcggtggtggccgcggtggcggcgccggcgggggaggcggtggctccgga
gccggggcaaccagtggaggggacgacctcggagcgaacgacgagctgatccccttccag
gacgaggggggcgaagagcaagagccgagcagcgacagcgcttcggcgcagagggatctg
gatgaagtcaagtcgtccctggtcaacgaatcggagaatcagagcagtagctcggactcc
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccgcgcgactatttc
gccgaagtgagaaggccccaggatggcgctttttttaagggacctgcgtaccctgggtac
cccttcctgatgattccagacctgagcagcccgtacctctccaacggtcccctgtctcct
ggtggagcgcgcacctatctacagatgaaatggcccctcctcgatgtcccctccagtgct
tcagtcaaggacacaagatcaccatctccagcacacttgtatggggatcctgcccgttgg
atggtgcctcccacgttcaggtccaacaaagttcctgttgttcagcaccctcatcacatg
cacccgctgacacctctcatcacctacagcaacgaccacttctcccctgcgtcccctccc
acgcatctgtccccagagatcgacccaaagacaggaatcccccggccccctcatccatct
gagctgtcaccgtattacccactgtctccaggagctgtcggacaaatcccccatcccctc
ggctggctcgtcccacagcaagggcagcccatgtactctctccctccgggtggtttccgg
catccttaccctgccctcgccatgaacgcttcaatgtccagcctggtctcaagtcggttc
ccacacatggtggctcctgcccatcctggcctgcccacctcaggaatcccccatcctgcc
atcgtctcccccatcgtgaagcaggagccagcgccccccagcctgagccctgcagtgagt
gcgaaatccccagttaccgtgaaaaaggaagaggagaagaaacctcacgtgaagaagcct
ctgaatgccttcatgttgtatatgaaggagatgagggccaaggtggtggccgagtgtacc
ctgaaggaaagtgcagccattaaccaaatcctgggaagaaagtggcacaacctgtcaaga
gaagaacaggccaaatactatgagcttgcccggaaagaacggcagcttcacgcgcagctc
tacccaacctggtcagcccgggacaactatgggaagaagaagaagaggaagagagaaaag
cagctgtcacagacacagtctcagccgcaaatccaagaggcagagggtgctctggcctca
aagagcaagaagccatgcattcagtacctgccccctgagaagccttgtgatagccctgcg
tcttcccacggcagcacgctggactcccctgcgacgccctccgcagccttggcctcacca
gctgccccagcggctacccactcggagcaagcccagcccctgtcactcaccaccaaaccg
gagacccgggcccagctggctctccactccgctgccttcctgtcggctaaggccgccgcc
agcaactctagccagatgggcagccagcccccactcctgtccaggcccttgcccttgggc
tctatgcccgccgctctgctgacctctcccccttctttcccagctacgctccatgcccac
caggcccttcccgtgctacaggcccagcctctttccttggtcaccaagtctgcccactaa

KEGG   Mus pahari (shrew mouse): 110319903
Entry
110319903         CDS       T05929                                 

Gene name
Lef1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05132  Salmonella infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110319903 (Lef1)
   04390 Hippo signaling pathway
    110319903 (Lef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110319903 (Lef1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110319903 (Lef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319903 (Lef1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110319903 (Lef1)
   05225 Hepatocellular carcinoma
    110319903 (Lef1)
   05226 Gastric cancer
    110319903 (Lef1)
   05216 Thyroid cancer
    110319903 (Lef1)
   05221 Acute myeloid leukemia
    110319903 (Lef1)
   05217 Basal cell carcinoma
    110319903 (Lef1)
   05215 Prostate cancer
    110319903 (Lef1)
   05213 Endometrial cancer
    110319903 (Lef1)
   05224 Breast cancer
    110319903 (Lef1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110319903 (Lef1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319903 (Lef1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110319903 (Lef1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110319903 (Lef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110319903 (Lef1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110319903 (Lef1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110319903
NCBI-ProteinID: XP_021051266
Ensembl: MGP_PahariEiJ_G0027086
LinkDB
Position
4
AA seq 397 aa
MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE
IIPASNGHEVVRQAPSSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNS
DPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQ
GMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSGDTSMSRF
SHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKP
LNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQL
YPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgccccaactttccggaggcggcggcgggggggacccggaactctgcgccaccgatgag
atgatccccttcaaggacgaaggcgatccccagaaggagaagatcttcgccgagatcagt
caccccgaagaggagggcgacttagccgacatcaagtcatccttggttaacgagtccgaa
atcatcccagccagcaacgggcatgaggtggtcagacaagccccgtcctctcaggagccc
taccacgacaaggccagagaacaccccgatgacggaaagcatccggacggaggcctgtac
aacaagggaccctcctactccagttactctggctacataatgatgcccaatatgaacagc
gacccgtacatgtcaaatgggtccctttctccacccatcccaaggacatcaaataaagtg
ccggtggtgcagccctctcacgcggtccaccctctcacccccctcatcacgtacagcgac
gagcacttttctccgggatcccacccgtcacacatcccgtcagatgtcaactccaagcaa
ggcatgtccagacaccctccagctcctgaaatccccaccttctaccccctgtctccgggc
ggcgttggacagatcaccccaccccttggctggcaaggtcagcctgtttatcccatcacg
ggtggattcaggcaaccctacccatcctcactgtcaggcgacacttccatgtccaggttt
tcccatcatatgattcctggtccccctggcccccacacaactggcatccctcatccagct
attgtaacacctcaggtcaaacaggaacacccccacacggacagcgacctaatgcacgtg
aagcctcaacatgaacagagaaaggagcaggagccaaaaagacctcacattaagaagcct
ctgaatgctttcatgttatatatgaaagaaatgagagcgaacgtcgtagccgagtgcacg
ctaaaggagagtgcggctatcaaccagattctgggcagaaggtggcacgccctctcccgg
gaagagcaggccaaatactatgaactagcacggaaggagaggcagctacacatgcagctt
tatccaggctggtcagcgcgagacaattacggcaagaagaagaagaggaagcgagagaag
ctacaggaatcgacttcaggtacaggtcccagaatgacagctgcctacatctga

KEGG   Mus pahari (shrew mouse): 110332085
Entry
110332085         CDS       T05929                                 

Gene name
Tcf7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05132  Salmonella infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110332085 (Tcf7)
   04390 Hippo signaling pathway
    110332085 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110332085 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    110332085 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110332085 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332085 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110332085 (Tcf7)
   05225 Hepatocellular carcinoma
    110332085 (Tcf7)
   05226 Gastric cancer
    110332085 (Tcf7)
   05216 Thyroid cancer
    110332085 (Tcf7)
   05221 Acute myeloid leukemia
    110332085 (Tcf7)
   05217 Basal cell carcinoma
    110332085 (Tcf7)
   05215 Prostate cancer
    110332085 (Tcf7)
   05213 Endometrial cancer
    110332085 (Tcf7)
   05224 Breast cancer
    110332085 (Tcf7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110332085 (Tcf7)
   05165 Human papillomavirus infection
    110332085 (Tcf7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110332085 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110332085 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110332085 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110332085 (Tcf7)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    110332085 (Tcf7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110332085
NCBI-ProteinID: XP_021068719
Ensembl: MGP_PahariEiJ_G0017460
LinkDB
Position
14
AA seq 419 aa
MPQLDSGGGGAGAGDDLGAPDELLAFQDEGEEQDDKNRDSAAGPERDLAELKSSLVNESE
GAAAGAGVPGPGVRVHGEAEGAPEALGREHTSQRLYPDKLPESLEDGLKAPECTSGMYKE
TVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGSMGQIPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAEKEAK
KPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKTAAPAPFLPMTVL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgccgcagttggactcgggcgggggcggcgcgggcgcaggcgacgacctcggcgcgccc
gacgagctgctggccttccaagacgaaggcgaggaacaggacgataagaatcgcgacagc
gctgcgggccccgagcgggacctggcggagctcaagtcctcactggtgaatgagtccgaa
ggcgcggccgcaggcgccggggtcccgggtcccggcgtccgagtacatggagaagccgag
ggagcgcccgaggccctgggacgggagcacacttcgcagagactttacccggacaaactt
ccagagtccctggaggacggcctgaaggccccggagtgtaccagtggcatgtacaaagag
actgtctactctgctttcaatctgctcatgccctacccaccggcctcgggagcagggcag
catccgcagcctcaaccccctctgcataacaagcctggccagccccctcatggcgtcccc
cagctttctccactctatgaacatttcagcagtccacaccccacccctgcaccagcggac
atcagccagaagcaaggagttcacaggccgctgcaaacccccgatctctctggattttat
tctctgacctcaggcagcatgggacagatcccccatactgtgagctggcccagccctcct
ctctaccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctatcccaggttcacccacccatccttgatgctaggatctggtgtacct
ggacacccagcagccatccctcacccagccatcgtgccctcctcagggaagcaggagctg
cagccatatgatagaaacctgaaaacacaggcagaacccaaggcagagaaggaggctaag
aagccagtcatcaagaaacccctcaatgctttcatgctttacatgaaggagatgagagcc
aaggtcattgccgagtgcacactcaaggagagcgctgccatcaaccagatcctgggtcgc
aggtggcatgcactatctcgagaggagcaggccaagtactatgagctggcccgcaaggaa
aggcagctgcacatgcagttatacccgggctggtccgcgcgggacaactatggaaagaag
aagaggcggtcaagggaaaagcatcaagaatccaccacaggaggaaaaagaaatgcattc
ggtacttacccggagaagaccgctgccccagccccgttccttccgatgacagtgctctag

DBGET integrated database retrieval system