KEGG   Mus pahari (shrew mouse): 110313442
Entry
110313442         CDS       T05929                                 
Symbol
Nlgn3
Name
(RefSeq) neuroligin-3 isoform X1
  KO
K07378  neuroligin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110313442 (Nlgn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110313442 (Nlgn3)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110313442 (Nlgn3)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3
Other DBs
NCBI-GeneID: 110313442
NCBI-ProteinID: XP_021043321
Ensembl: MGP_PahariEiJ_G0031823
LinkDB
Position
X:87333550..87356268
AA seq 845 aa
MWLQPSLSLSPTPTVGRSLCLTLGFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEIL
GPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWF
TANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQGEDL
ADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVGVLG
FLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHS
EGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQ
DIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPEDG
VSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTDHQW
VEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFP
CNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLY
LHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPN
GKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLFLNV
LAFAALYYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGPPHDT
LRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLPHSH
STTRV
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgtggctgcagccctcgttgtccctgagccccacgcccacagttggccggagcctgtgc
ctcaccctgggcttcctcagtttggtgctgagggccagtacccaggccccggcacccaca
gtcaatactcactttgggaagctaaggggtgccagagtaccattgcccagtgaaatcctg
ggtcctgtggaccaatacctgggggtaccctacgcagctcccccgatcggcgagaaacgt
ttcctgccccctgaaccacccccatcctggtcgggcatccggaacgccacacactttccc
ccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgctgccagtctggttc
actgccaacttggatatcgtcgccacttatatccaggagcccaacgaagattgcctctat
ctgaatgtgtatgtgcccacggaagatgtaaagcggatttccaaggaatgcgcccgaaag
cccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggcgaggactta
gcggataatgacggggatgaagatgaagacatccgagacagtggtgctaaacctgtcatg
gtctacatccacggaggctcttacatggaaggaacaggcaacatgattgatggcagtgtt
cttgcaagttacggcaacgtcatcgtcatcaccctcaactatcgggtcggggtgctaggt
ttcctgagcactggggatcaggctgccaagggcaactatgggctccttgatcaaatccag
gcccttcgctgggtgagtgagaatattgccttctttggaggagatccccgtagaattact
gtctttggctctggcatcggtgcatcctgtgtcagtctcctcacactgtctcatcattct
gaggggcttttccagagggccatcatccaaagtggctccgctctatctagctgggctgtg
aactaccaaccagtgaagtacaccagcttgctggcagacaaagtgggctgtaacgtcctg
gacactgtggatatggtggattgtcttcgacaaaagagtgccaaggagctggtagaacag
gacattcagccagcccgctaccatgtggcttttggccctgtgattgatggtgatgtcatt
cctgatgaccctgagatcctcatggaacagggagagttcctcaactatgatatcatgcta
ggcgtcaaccagggtgagggtctcaagtttgtggaaggggtggtggaccccgaggatggt
gtctctggcactgactttgactactctgtctccaattttgtggacaatctgtatggctat
cctgagggtaaggacaccctgcgggagactatcaagttcatgtatacggactgggcagac
cgagacaaccctgagacccgccgtaaaacactggtggcactcttcactgaccaccagtgg
gtggagccttcagtggtgacagctgatctacacgcccgctatggctcacctacctacttc
tacgccttctaccatcactgccagagcctcatgaagcccgcatggtcagatgcagcacac
ggggatgaagtgccctatgtttttggtgtccctatggtagggcccactgaccttttcccc
tgcaacttctccaagaatgatgttatgctcagtgctgttgtcatgacgtattggaccaac
tttgccaagaccggggatcccaacaagccggtaccccaggataccaagttcattcacacc
aaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgggaccagctctac
cttcacatcgggctgaaaccaagggttcgtgatcattatcgggccacaaaggtagccttt
tggaaacacctggtgccccacctgtacaacctgcatgacatgttccactatacatccacg
accaccaaagtgccgcccccggacaccacccacagctcccacatcacccgtaggcccaac
ggcaagacctggagcaccaagcggccagccatctcacctgcctacagcaatgagaatgcc
cctgggtcctggaatggggaccaggatgcggggccactcctggtcgagaaccctcgagac
tactccactgaattaagtgtcactatcgctgtgggggcctccctcctgtttctcaatgtg
ttggcctttgctgccctctattaccgtaaggacaaacggcgccaggagcccctgaggcag
cctagcccccaaaggggaactggtgcccctgaattgggaactgctccggaggaggagctg
gcagcattgcagttgggtcccactcaccatgaatgtgaggccggccccccacatgacaca
ctgcgcctcacagcactgcccgactataccctgaccctgcggcgctcccctgatgacatc
ccactcatgactcccaacaccatcactatgattcctaattccctggttgggttgcagacc
ttgcacccctataacacctttgccgcagggttcaacagtaccgggctgccccactcacac
tccactacccgtgtatag

KEGG   Mus pahari (shrew mouse): 110320059
Entry
110320059         CDS       T05929                                 
Symbol
Nlgn1
Name
(RefSeq) neuroligin-1 isoform X1
  KO
K07378  neuroligin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110320059 (Nlgn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110320059 (Nlgn1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110320059 (Nlgn1)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE
Other DBs
NCBI-GeneID: 110320059
NCBI-ProteinID: XP_021051592
Ensembl: MGP_PahariEiJ_G0026330
LinkDB
Position
4:complement(20411058..21278711)
AA seq 863 aa
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDDVDPLVTTNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDVKRISKECARKPGKKI
CRKGGPLTKKHTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASY
GNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGS
GAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKV
GCNVSDTVELVECLQKKPYKELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLN
YDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMY
TDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAW
ADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDT
KFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDIS
QYTSTTTKVPSTDITLRPTRKNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTI
AVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDL
DHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTF
TGGQNNTLPHPHPHPHSHSTTRV
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggcacttcccagatgcatgtggccaaattatgtttggagagccatgatggcatgtgtg
gtccacaggggatcaggtgctccattgactctctgcttgttgggatgtttgctacagact
tttcacgtactctctcaaaagttggatgatgtagacccattggttactactaactttggc
aagattaggggaattaagaaagaactcaacaatgaaattttgggtcctgtcattcagttt
cttggggttccatatgccgctccaccaacaggagaacatcgtttccagcctccagaacca
ccatctccctggtctgacatccggaatgccactcagtttgctcctgtgtgtccccagaat
atcattgatggcaggttgccggaagttatgcttcctgtgtggttcactaataacttggat
gtggtttcatcatacgtccaagaccagagtgaagactgtctatacttaaacatctatgtc
ccaaccgaagatgtaaaaagaatatccaaggaatgtgccagaaaacccggcaagaaaata
tgtagaaaaggaggtccccttacaaagaaacacacagatgatttaggtgataatgacggt
gctgaagatgaagatattcgggacagtgggggtcccaaaccagtgatggtgtacatccat
ggcggctcttacatggaaggtactggaaatctgtatgatgggagtgtcttggcaagctat
ggcaatgtgatcgtcatcacagtcaactatcggcttggggtacttggcttcttgagcaca
ggggatcaggctgccaaaggaaactacgggctccttgacctcatccaggccctaagatgg
accagcgagaacattgggttctttggtggtgaccccttgcgaatcactgtgtttggatca
ggcgctgggggttcttgtgtcaatctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcagagtggaacagccctt
tccagctgggctgttagtttccagcctgcaaaatacgctagaattctggccacaaaagtt
ggctgcaatgtatcagatacagtagagttagtagaatgcctgcagaagaagccttacaaa
gaacttgttgatcaagatgttcaaccagcccgataccacatagcctttggacctgtgatc
gatggtgatgtaataccagatgaccctcagatactgatggaacaaggagagttcctcaac
tatgatataatgttgggagttaaccaaggggaagggttgaagtttgttgaaaatatagta
gatagtgatgatggtgtatcagccagtgatttcgactttgctgtttctaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaaattcatgtat
actgactgggctgatcgccataaccctgaaactagaaggaagacattgttggctttgttt
acggaccatcagtgggtggcaccggctgtggctacagcagaccttcactcgaactttggc
tcacctacatacttctatgccttttatcatcattgccaaacagatcaagttccagcttgg
gctgatgcagctcacggggatgaggttccctatgtgttgggaatccccatgattggccct
acagagttatttccttgcaatttctccaagaatgatgtgatgttgagtgccgtagtaatg
acatactggacaaattttgctaaaaccggtgacccaaatcaaccagttcctcaagacaca
aaattcattcataccaaacccaaccgctttgaagaagtagcatggaccagatattcccag
aaagaccaactttatctccacattggtttaaaaccgagagttaaagagcattacagagcc
aataaggtaaatctctggctggagctggtacctcatctgcataatctcaatgacatttct
cagtatacctcgacaacaactaaagtgccatccacggacatcactctcagacctacaagg
aagaattccacaccagtcacatcagcctttcccactgccaaacaggatgatcccaagcaa
cagccaagtcccttctcggtggatcagagggactactccacagagctaagtgtcactatc
gcagtgggagcctctctgttgtttctgaacatcttggcttttgccgccctgtactacaag
aaggataagaggagacatgatgttcaccggaggtgcagccctcagcgcacgaccaccaat
gacctaacccatgctccagaagaggaaatcatgtcactccaaatgaagcacactgacttg
gatcacgagtgtgagtccatccatccacatgaggtggttcttcggaccgcctgcccccca
gattatactctagctatgaggaggtcacctgatgatgtgccgttaatgacacctaacacc
atcacaatgattcccaacactataccagggattcagcccttacatacattcaacacattt
actggaggacagaataatacactgccccatccccacccgcacccccattcacattcaaca
accagggtatag

KEGG   Mus pahari (shrew mouse): 110331101
Entry
110331101         CDS       T05929                                 
Symbol
Nlgn2
Name
(RefSeq) neuroligin-2 isoform X1
  KO
K07378  neuroligin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110331101 (Nlgn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331101 (Nlgn2)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110331101 (Nlgn2)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE Peptidase_S9
Other DBs
NCBI-GeneID: 110331101
NCBI-ProteinID: XP_021067137
Ensembl: MGP_PahariEiJ_G0017726
LinkDB
Position
14:complement(37669787..37684597)
AA seq 836 aa
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRTPGPGTSGTRRPPPPATLPPESDIDLGP
RAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSG
SGVPGGGPLLPTAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDD
VPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgtggctcctggcgttgtgtctggtggggctggctggggctcaacggggaggagggggt
cccggcggcggcgccccgggcggcccaggcctgggcctcggcagcctcggggaggagcgc
ttccccgtggtgaacacagcctacgggcgagtgcgcggtgtgcggcgcgagctcaacaac
gagatcctgggcccggtcgtgcagttcttgggcgtgccctacgccacgccgcccttgggc
gcccgccgcttccagccgcctgaggcacctgcctcgtggcccggcgtgcgcaacgccacc
accctgccgcccgcctgcccgcagaacctgcacggggccctgccggccatcatgctgcct
gtgtggttcaccgacaacttggaggcggccgccacctacgtgcagaaccagagcgaggac
tgcctgtacctcaacctctacgtgcccactgaggacggtccgctcacaaaaaaacgtgac
gaggcgacgctcaatccgccagacacagatatccgggactctgggaagaaaccagtcatg
ctgtttctacacggcggctcctacatggaaggcaccgggaacatgttcgacggctcagtc
ctggctgcctatggcaatgtcatcgtagtcacactcaactaccgtcttggggtgctcggt
tttctcagcactggtgaccaagctgcaaaaggcaactatgggctcctggaccagatccag
gccctgcgctggctcagtgaaaacattgcccactttggaggtgaccctgaacgcatcaca
atctttggatctggtgcaggggcctcctgtgtcaacttgttgatcctctcccaccactca
gaaggactgttccagaaggccattgctcagagtggtactgccatttccagctggtctgtc
aactaccagccgctcaagtacacgcggctgctggcggccaaagtgggctgtgaccgagag
gacagcaccgaagctgtggagtgtctgcgccggaagtcttcccgggagctagtggaccag
gatgtgcagcctgcccgctaccacattgcctttgggcctgtggtggacggcgacgtagtc
cctgacgaccccgagatcctcatgcaacagggagagttcctcaattacgacatgctcatt
ggtgtcaaccagggagagggtcttaagttcgtggaagactctgcagagagtgaggacggt
gtgtctgccagcgcctttgacttcaccgtctccaactttgtggacaacttgtacgggtac
ccggaaggcaaggacgtgcttcgcgagaccatcaagttcatgtacacggactgggctgac
cgggacaatggcgagatgcgacggaagaccctgctggcgctctttaccgaccatcagtgg
gtcgccccggcagtggccaccgccaagctgcatgccgactaccagtcccccgtctacttt
tacactttctaccaccactgccaggctgagggccggccagagtgggcagacgcagcgcac
ggggatgagctgccctacgtcttcggtgtgcccatggtgggtgccactgacctctttccc
tgcaacttctccaagaatgacgtcatgctcagcgcggtagtcatgacctactggaccaac
ttcgccaagactggtgaccccaaccagcctgtgccacaggacaccaagttcatccacacc
aagcccaaccgctttgaagaggtagtgtggagcaagttcaacagcaaggaaaagcagtac
ctgcacataggcttgaaaccgcgcgtgcgcgacaactaccgtgccaacaaggtggccttc
tggctggagctcgtgccccacctgcacaacctgcacacagagctcttcaccaccaccact
cgcctgcctccctatgccacacgctggccacctcgcacacccggtcccggcacttccggc
acacgccgtcctcccccacccgccactctgccacctgagtctgatattgacctaggccca
agggcctatgaccgcttcccgggtgactcgagggactactccacggagctaagcgtgact
gtggcagtgggtgcctccctcctcttcctcaacatccttgcctttgccgccctctactac
aagcgggaccggcgccaggagctgcggtgccggcggcttagcccaccaggaggctcaggc
tcaggtgtgcctggtgggggccccctgcttcccactgctggccgcgagctacccccggag
gaggagctggtgtcactgcagctgaagcggggtggtggtgttggggcggaccctgctgag
gccctgcgccctgcctgtccacccgactataccctggccttgcgccgggcaccggacgat
gtgcctctcttggcccccggggccctgaccctgctgcctagtggcctggggcccccaccc
ccgcccccacccccttctctccatccctttgggcccttcccacccccgccccctactgct
accagccacaacaacacgctaccccatccccactccaccactcgggtatag

DBGET integrated database retrieval system