KEGG   Mus pahari (shrew mouse): 110314261
Entry
110314261         CDS       T05929                                 

Gene name
Lrp6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05200  Pathways in cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110314261 (Lrp6)
   04150 mTOR signaling pathway
    110314261 (Lrp6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110314261 (Lrp6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110314261 (Lrp6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110314261 (Lrp6)
   05226 Gastric cancer
    110314261 (Lrp6)
   05224 Breast cancer
    110314261 (Lrp6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110314261 (Lrp6)
   05022 Pathways of neurodegeneration - multiple diseases
    110314261 (Lrp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110314261 (Lrp6)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110314261 (Lrp6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Other DBs
NCBI-GeneID: 110314261
NCBI-ProteinID: XP_021044361
Ensembl: MGP_PahariEiJ_G0022740
LinkDB
Position
2
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVKAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRAIGSNPCAEDNGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQGFNVVASSAPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVIDVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGD
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHSPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTSVTTAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtgctgaggagcctcctggcctgcagcttctgcgtgctgctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgagattggttgatgctacaaatggcaaa
gagaatgcaacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtacagaatgttgttgtttctggattattgtccccggatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcgtatcgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaacca
agagctattgccttagatccatcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagagcgtgctgggatggatggctcaagtcgcttcgttataataaacaccgag
atttactggccaaacggactgactctggattatcaggagcggaagctttactgggccgat
gcaaaacttaatttcatccataaatcaaacctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gactggaatacacactctattttggcttgcaacaaatatactggcgagggtctgcgtgaa
attcattctaacatcttctctcccatggatatacatgctttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccaactggggtcaagcttctggagaatgga
aagacctgcaaagatggtgccactgaactattgctgttagcccgacggacagacttgagg
cgaatttctttggatacacctgattttactgacattgtcctgcagttagaagatatccgg
catgccattgccatagactacgatcctgtagaaggctacatatactggactgatgacgaa
gtgaaggccatccgtcgctctttcatagatggatctggcagtcagtttgtggtcacggcc
cagattgctcatcctgatggtattgctgttgactgggttgcaaggaacctgtactggaca
gacactggcacggatcgcatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggagccccgggctatcgtgttagatcccatggttgggtacatg
tattggacagactggggagaaatcccaaaaatagagcgagctgctctggacggatctgac
cgagtagttcttgtcaacacttcccttggttggccaaatggcttagccctggattatgat
gaaggcacaatatactggggagacgccaaaacagacaaaattgaggttatgaataccgat
ggcaccgggaggcgagtgctggtggaagacaagatccctcacatatttgggtttaccttg
ctgggagactatgtttactggactgactggcagaggcggagcatcgagagagtacacaaa
cggagtgcagagagggaggtcatcatagaccagctgccagacctcatgggactgaaggcc
acaagtgttcacagagccattggttctaatccctgtgctgaggacaatggaggatgtagc
catctttgcctatacaggcctcaggggcttcgatgcgcctgtcccattggctttgagctc
atcagtgacatgaagacatgcattgtccccgaggctttccttctgttctcacggagagcg
gatatcagacgcatatctttggaaacaaacaacaacaatgtggccattcctctcactggt
gtcaaagaagcttctgctttggattttgatgtcacagacaacagaatttactggactgat
atatcactgaagactattagcagagcctttatgaatggcagtgcactggaacatgtggta
gagtttggcttagattatccagaaggcatggcagtggactggcttgggaagaacttatac
tgggcagacacaggaacaaatcgcattgaggtatcaaagttggacggacagcaccggcag
gttttggtatggaaagaccttgacagtcctcgagctctggcactggatcctgctgaaggg
tttatgtattggactgagtggggagggaaacctaagattgacagggctgctatggacgga
agtgaacgcacgacattagttccaaatgtgggccgagcaaatggcctcaccatcgactat
gctaaaaggcggctttactggacagacctggacactaacctaatagaatcctcaaatatg
ctcggcctcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacagactggagccgacgcagcatcgaacgtgccaacaaa
accagtggccaaaaccgcaccatcatccagggccatttggactatgtgatggacatcctg
gtcttccactcttcccggcaggcagggtggaatgagtgcgcctccagcaatgggcactgc
tcccacctctgcttggctgtacccgtgggaggctttgtgtgtggatgccctgcccactac
tccctgaatgctgacaacaggacctgcagtgctcctaccaccttcctgctcttcagtcag
aagagcgccatcaaccgcatggtgattgatgaacaacagagccctgacatcatccttcct
atccacagccttcggaatgtccgggccattgattatgaccctttggacaagcagctctac
tggattgactctcgacagaactcgatacgaaaggcacatgaagatggtggccaggggttt
aatgtagttgcaagctcagccccaaatcagaaccttgaaatacagccctatgatctcagc
attgatatttatagccgttacatctactggacctgtgaagctaccaatgtcattgatgtg
acaagattagatggacgatcagttggggtggttctaaaaggcgagcaagacagacctcga
gccattgtggtaaaccccgagaaagggtatatgtattttaccaatcttcaggaaagatct
cctaaaattgaacgggctgcattggatggtacagagcgagaggtcctctttttcagtggc
ttaagtaaaccgattgctttggctcttgatagcaagctgggcaagctcttctgggccgac
tcagatctccggcgaattgaaagcagcgatctctcaggtgccaacaggatagtgctagaa
gactctaatatattacagcctgtgggcctgactgtgtttgaaaactggctctattggatt
gataaacagcagcagatgattgaaaaaattgacatgactggtcgagaaggaagaaccaag
gtccaggctcgaattgctcagctgagtgacatccatgcagtaaaggagctgaaccttcag
gagtacagacagcacccttgtgcccaggataatggtggctgttcacatatttgccttgta
aaaggagatggtactacaagatgctcctgccccatgcacttagttctgcttcaggatgag
ctgtcctgtggagagcctccgacatgttctcctcagcagtttacctgcttcactggagac
attgactgcatccctgtggcttggcggtgcgatgggttcactgaatgcgaagaccacagc
gatgaactcaattgtcctgtgtgctcagagtctcagttccagtgtgccagcgggcagtgc
attgatggtgcccttcgatgcaatggtgatgcgaactgccaggacaaatcagacgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcaatgcgttgga
aagcacaagaaatgtgaccacagtgtggactgcagtgacagatctgacgaactggactgt
tatccaactgaggagccagcaccacaggccaccaacacagttggttccgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccaaaggatgctgtgtcct
cgtatgaagggagacggggagaccatgactaatgactatgtggttcacagcccagcatct
gttccccttggttatgttcctcacccaagctctctctctggatctcttccaggaatgtct
cgaggcaaatcaatgatcagttccctcagtatcatgggaggaagcagtgggcctccctac
gatcgagcgcacgtcacgggagcatcctcaagcagttcttcaagtaccaaaggcacttac
ttccctgcaattttgaacccaccaccatcgcctgccactgaaagatcccattataccatg
gaatttggttattcttccaacagtccttccacacataggtcctacagctacaggccgtac
agctaccggcactttgcaccgcccaccacaccctgcagcactgatgtctgtgacagtgac
tatgctcctagccgaagggtgacctcagtgacaacagccaagggctacaccagtgacttg
aactatgactcagaacctgtgcccccaccacccacaccccgaagccagtacctgtcagca
gaggagaactatgaaagctgccccccttccccatacacggagaggagttactcccaccac
ctctacccaccaccaccctccccctgcacggactcctcctga

KEGG   Mus pahari (shrew mouse): 110338873
Entry
110338873         CDS       T05929                                 

Gene name
Lrp5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05200  Pathways in cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110338873 (Lrp5)
   04150 mTOR signaling pathway
    110338873 (Lrp5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110338873 (Lrp5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338873 (Lrp5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110338873 (Lrp5)
   05226 Gastric cancer
    110338873 (Lrp5)
   05224 Breast cancer
    110338873 (Lrp5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110338873 (Lrp5)
   05022 Pathways of neurodegeneration - multiple diseases
    110338873 (Lrp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110338873 (Lrp5)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110338873 (Lrp5)
SSDB
Motif
Pfam: Ldl_recept_b Ldl_recept_a FXa_inhibition DUF5050 SGL Insulin_TMD Gp3-like
Other DBs
NCBI-GeneID: 110338873
NCBI-ProteinID: XP_021078031
Ensembl: MGP_PahariEiJ_G0013966
LinkDB
Position
1
AA seq 1617 aa
METAPTRAPPPPPPPPLLLLLLVLCCSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIV
ASGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQSIVISGLVSPDGLACDWV
GKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIER
AGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLT
HPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPMDIQVLSQERQPPFHTP
CEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLD
TPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDP
DGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDW
GENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRQ
TLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAK
VVGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRI
SLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLD
YPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWT
EWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQER
MVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSS
RQDGLNDCVHSNGQCGQLCLAIPGGHRCGCASHHTLDPSSRNCSPPSTFLLFSQKFAISR
MIPDDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPSMLTSPSQ
SLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAER
GYMYFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIES
CDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHL
TGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPT
CSPDQFACTTGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCD
GEADCQDRSDEANCDAVCLPNQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSD
DMPAHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFI
APGGSQHGPFPGIPCSKSMMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPIL
NPPPSPATDPSLYNVDMFYSSGIPATARPYRPYVIRGMAPPTTPCSTDVCDSDYSTSRWK
TSKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
NT seq 4854 nt   +upstreamnt  +downstreamnt
atggaaacggcgccgacccgggcccctccgccgccgccgccgccgccgctgctgctgctg
ctgctggtgctgtgctgcagcctggtccccgccgcggcctcaccgctcctgttgtttgcc
aaccgccgggatgtgcggctagtggatgccggcggagtgaagctggagtccaccattgtg
gccagtggcctggaggatgcagctgctgtagacttccagttctccaagggtgctgtgtac
tggacagatgtgagcgaggaggccatcaaacagacctacctgaaccagactggagctgct
gcacagagcattgtcatctctggccttgtgtcacctgatggcctggcctgtgactgggtt
ggcaagaagctgtactggacggactccgagaccaaccgcatcgaggtggccaacctcaat
gggacatcccgtaaggtcctcttctggcaggacctggaccagccgagggccattgccctg
gatcctgcacatgggtacatgtactggactgactggggggaagcaccccggatcgagcgg
gcagggatggatggcagtacccggaagatcatcgtagactctgacatttactggcccaat
gggctgaccattgacctggaggagcagaagctgtactgggccgacgccaagctcagcttc
atccaccgtgccaacctggacggctccttccggcagaaggtggtggagggcagcctcact
cacccctttgccctgacgctctctggggacacactctactggacagactggcagactcgc
tccatccacgcctgcaacaagtggacgggggagcagaggaaggagatcctcagtgctctg
tactcacccatggacatccaggtgctgagccaggagcggcagcctcccttccacacgcca
tgcgaggaggacaacggcggctgctcccacctgtgcctgctgtccccgagggagcctttc
tactcctgtgcctgccccactggtgtgcagttgcaggacaatggcaagacgtgtaaggca
ggggctgaggaagtgctgttgctggctcggaggacagacctgaggaggatctctctggac
acccctgacttcacagacatagtgctgcaggtgggcgacatccggcacgccattgccata
gactacgatcccctggagggctacgtgtactggaccgatgatgaggtgcgggctatccgc
agggcgtacctggatggctcgggtgcgcagacacttgtgaacactgagatcaatgaccct
gatggcattgctgtggactgggtcgcccggaacctctactggacagatacaggcactgac
agaattgaggtgactcgcctcaacggcacctcccgaaagatcctggtatctgaggacctg
gatgaaccacgggccattgtgttgcaccctgtgatgggcctcatgtactggacagactgg
ggggagaaccccaaaatcgaatgtgccaacctagatgggagagatcggcatgtcctggtg
aacacctcccttgggtggcccaacggactggccctggacctgcaggagggcaagctgtac
tggggggatgccaaaactgataaaatcgaggtgatcaacatagacgggacaaagcggcag
accctgctcgaggacaagcttccgcacatttttgggttcacactgctgggagacttcatc
tactggaccgactggcagagacgcagtattgaaagggtacacaaggttaaggccagccgc
gatgtcatcatcgatcaactccccgacctaatgggactcaaagccgtgaatgtggccaag
gttgttggaaccaacccgtgtgcggacggaaatggagggtgcagccatctgtgcttcttc
accccacgtgccaccaagtgtggctgccccattggcctggagctgttgagtgacatgaag
acctgcataattcccgaggccttcctggtgttcaccagcagagccaccatccacaggatc
tccctggagactaacaacaacgatgtggccatcccactcacgggtgtcaaggaggcctct
gcactggactttgatgtgtccaacaaccacatctattggactgatgtcagcctcaagacg
atcagcagagccttcatgaatgggagttcagtggagcacgtgattgagtttggcctcgac
taccctgaaggaatggctgtggactggatgggcaagaacctctattgggcggacacaggg
accaacaggattgaggtggcccggctggatgggcagttccggcaggtgcttgtgtggaga
gaccttgacaaccccaggtctctggctctggatcctactaaaggctacatctactggacc
gagtggggtggcaagccaaggatcgtgcgggccttcatggatgggaccaattgtatgaca
ctggtagacaaggtgggccgagccaacgacctcactattgattacgctgaccagcgactg
tactggactgacctggacaccaacatgattgagtcctccaacatgctgggtcaggagcgc
atggtgatagctgacgatctgccctacccgttcggcctgactcaatatagcgattacatc
tactggactgactggaacctgcatagcattgaacgagcggacaagaccagcgggcggaac
cgcaccctcatccagggtcacctggacttcgtcatggacatcctggtgttccactcctcc
cgtcaggatggcctcaacgactgcgtgcacagcaacggccagtgcgggcagctgtgcctc
gccatccccggaggccaccgctgtggttgtgcttctcaccacacgctggaccccagcagc
cgcaactgcagcccgccctccaccttcttgctgttcagccagaaatttgccatcagccgg
atgattcccgatgaccagctcagcccggatcttgtcctacctcttcatgggctgaggaat
gtcaaagccatcaactacgacccgctggacaagttcatctactgggtggacgggcgccag
aacatcaagagggccaaggacgacggtacccagccctccatgctgacctcgcccagccaa
agcctgagcccagacagacagccgcatgacctcagcattgacatctacagccggacactg
ttctggacctgcgaggccaccaacaccatcaatgtccaccggctggatggggatgccatg
ggagtggtgcttcgaggggaccgtgacaagccaagggccattgctgtcaatgctgagcga
gggtacatgtactttaccaacatgcaggaccatgctgccaagattgagcgagcctcccta
gatggcacagagcgtgaggtcctcttcaccacaggcctcatccgtcccgtggcccttgtg
gtggacaatgctctgggcaagctcttctgggtggatgcagacctgaagcgcatcgaaagc
tgtgacctctccggggccaaccgcctgaccctagaagatgccaacatcgtgcagccagta
ggtctgacggtgctgggcaggcacctctactggatcgaccgccagcagcagatgatcgaa
cgcgtggagaagaccactggggacaaacggactagggtccagggccgtgtcacccacctg
acgggcatccatgcggtggaggaagtcagcctggaggagttctcagcccatccatgtgcc
cgagacaatggcggctgctcccacatctgcatcgccaagggtgatggaacaccacgttgc
tcatgccctgtccacctggtgctcctgcagaacctgctgacttgtggtgagcctcctacc
tgctcccctgatcagtttgcatgtaccactggtgagatcgactgcatccccggagcctgg
cgctgtgacggcttccctgagtgtgctgaccagagcgatgaagaaggctgcccagtgtgc
tctgcttctcagttcccctgcgctcggggccagtgtgtggacctgcggttacgctgtgat
ggggaggccgactgccaggatcgctctgatgaagctaactgcgatgctgtctgtctgccc
aatcagttccggtgcaccagcggccagtgcgtcctcatcaagcaacagtgtgactccttc
cccgactgtgctgatgggtctgatgagctcatgtgtgaaatcaacaagccaccctctgat
gacatgccagcccacagcagtgccattgggcccgtcattggcatcatcctctccctcttc
gtcatgggcggggtctactttgtctgccagcgtgtgatgtgccagcgctacacaggggcc
agtgggccctttccccacgagtatgtcggtggagcccctcatgtgcctctcaacttcata
gccccaggtggttcacagcacggtcccttcccaggcatcccgtgcagcaagtccatgatg
agctccatgagcctggtgggggggcggggcagcgtgcccctctatgaccggaatcacgtc
actggggcctcatccagcagctcgtccagcacaaaggccacactatatccgccgatcctg
aacccacccccatccccggccacagacccctccctgtacaacgtggacatgttttattct
tcaggcatcccggccaccgccagaccatacaggccctacgtcattcgaggtatggcaccc
ccaacaacaccgtgcagcacagatgtgtgtgacagcgactacagcaccagtcgctggaag
accagcaaatactacctggacttgaattcggactcagacccctacccacccccgcccact
ccccacagccagtacctatctgcagaggacagctgcccaccctcgccagtcactgagaga
agctactgccacctcttcccaccccctccgtccccctgcacagactcgtcctga

DBGET integrated database retrieval system