KEGG   Mus pahari (shrew mouse): 110314416
Entry
110314416         CDS       T05929                                 

Name
(RefSeq) profilin-1-like
  KO
K05759  profilin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110314416
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110314416
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110314416
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110314416
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110314416
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110314416
   04147 Exosome [BR:mpah04147]
    110314416
Membrane trafficking [BR:mpah04131]
 Others
  Actin-binding proteins
   Others
    110314416
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     110314416
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314416
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 110314416
NCBI-ProteinID: XP_021044447
LinkDB
Position
X
AA seq 153 aa
MQSIEDVSQEIWQDCIKMCLQYEICNDAAIITNSPPWLLASPPEGNFLQITQEEIQTLLA
REGREKLFLQGVTLAGIRCLLIRDNLFTQGNNSMDLRTKGQSRGSQAVTIVQMESVYLVV
MGKKGTEGGPLNLKAFEIAGYMREAILQNMARS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgcagagtatcgaggatgtcagccaagaaatctggcaagattgtatcaaaatgtgccta
caatatgagatatgcaatgatgcagcaattatcaccaactctccaccatggttattagct
tctcctcctgaaggaaactttcttcagatcacccaggaagaaattcagaccttactggca
agagagggtagagaaaaactgtttctccagggagtcacccttgctggaatcagatgcctg
ttgatccgagacaacttgttcacccaaggcaacaacagcatggacctccgtaccaaaggc
caaagtcgaggtagccaggcagtgactatagttcagatggagtctgtgtatcttgtggtg
atgggaaagaaggggacagaaggaggacctctcaacctcaaagcttttgagatcgcaggc
tacatgagagaggccattcttcaaaacatggcccgttcctaa

KEGG   Mus pahari (shrew mouse): 110320000
Entry
110320000         CDS       T05929                                 

Symbol
Pfn2
Name
(RefSeq) profilin-2 isoform X1
  KO
K05759  profilin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110320000 (Pfn2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110320000 (Pfn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110320000 (Pfn2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110320000 (Pfn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110320000 (Pfn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110320000 (Pfn2)
   04147 Exosome [BR:mpah04147]
    110320000 (Pfn2)
Membrane trafficking [BR:mpah04131]
 Others
  Actin-binding proteins
   Others
    110320000 (Pfn2)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     110320000 (Pfn2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110320000 (Pfn2)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 110320000
NCBI-ProteinID: XP_021051469
Ensembl: MGP_PahariEiJ_G0026450
LinkDB
Position
4
AA seq 140 aa
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagtagaaatagatatgattgtagggaaagaccgggaaggcttcttt
accaacggtttgactcttggagcaaagaagtgctctgtgatcagagatagtctatacgtg
gacggtgactgcacaatggacatccggacaaagagtcaaggtggagagccaacatacaac
gttgctgttggcagagccgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggcttgaataagaaggcgtactcaatggcaaagtacttgagagactctgggttc
tag

KEGG   Mus pahari (shrew mouse): 110324882
Entry
110324882         CDS       T05929                                 

Symbol
Pfn4
Name
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110324882 (Pfn4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324882 (Pfn4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110324882 (Pfn4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110324882 (Pfn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110324882 (Pfn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110324882 (Pfn4)
   04147 Exosome [BR:mpah04147]
    110324882 (Pfn4)
Membrane trafficking [BR:mpah04131]
 Others
  Actin-binding proteins
   Others
    110324882 (Pfn4)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     110324882 (Pfn4)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110324882 (Pfn4)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 110324882
NCBI-ProteinID: XP_021058268
Ensembl: MGP_PahariEiJ_G0029347
LinkDB
Position
7
AA seq 129 aa
MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTR
REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKL
GEYLRKRGN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagtcacttgcaaaacttactgttagacaccctactggggacaaagcatgtggacagt
gcagccctcatcaaactccaagaaaagactctgtgtgtgacatcaccaggatttagtgta
atgccaagtgatgttcgaacacttttgaatggatttgccaaaaacccattattaacccga
agggaagggttgtatttcaaggaaaaggattacaaatgtgtccgggcagatgactattct
ctctatgctaagaatgaaaacactggtgtggtggtggtgaagaccaacatgtatcttgtg
gtggcaacttacacagcaggcatgtatcctagtgtctgcgtggaagccacagagaagctg
ggagagtatctaaggaaaaggggaaactaa

KEGG   Mus pahari (shrew mouse): 110331523
Entry
110331523         CDS       T05929                                 

Symbol
Pfn1
Name
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110331523 (Pfn1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331523 (Pfn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110331523 (Pfn1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110331523 (Pfn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331523 (Pfn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110331523 (Pfn1)
   04147 Exosome [BR:mpah04147]
    110331523 (Pfn1)
Membrane trafficking [BR:mpah04131]
 Others
  Actin-binding proteins
   Others
    110331523 (Pfn1)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     110331523 (Pfn1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110331523 (Pfn1)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 110331523
NCBI-ProteinID: XP_021067863
Ensembl: MGP_PahariEiJ_G0017776
LinkDB
Position
14
AA seq 140 aa
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMATHLRRSQY
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagctttttc
gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaattcacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggccactcacctgcggcgttcccagtac
tga

KEGG   Mus pahari (shrew mouse): 110333988
Entry
110333988         CDS       T05929                                 

Symbol
Pfn3
Name
(RefSeq) profilin-3
  KO
K05759  profilin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05014  Amyotrophic lateral sclerosis
mpah05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110333988 (Pfn3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333988 (Pfn3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110333988 (Pfn3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110333988 (Pfn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110333988 (Pfn3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110333988 (Pfn3)
   04147 Exosome [BR:mpah04147]
    110333988 (Pfn3)
Membrane trafficking [BR:mpah04131]
 Others
  Actin-binding proteins
   Others
    110333988 (Pfn3)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     110333988 (Pfn3)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110333988 (Pfn3)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 110333988
NCBI-ProteinID: XP_021071462
Ensembl: MGP_PahariEiJ_G0019626
LinkDB
Position
16
AA seq 137 aa
MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI
LNKTVHDLIGGLREQCS
NT seq 414 nt   +upstreamnt  +downstreamnt
atgagtgactggaagggctacatcagtgcggtgctgcgggatcagcgtatcgatgacgtg
gctatcgtaggccactcggacaatcgctgtgtgtgggcatcgcggcctgggggtctgctg
gcggccatctccccgcaggaggtgggtgtgctcaccgggccggaccggcacacctttctg
cagacgggtctgagcgtggcaggccgccgctgctgcgttatccgtgactacctgctggcc
gagggtgacggcgtactggatgcgcgcaccaaggggctggacgggcgtgcaatctgtgtg
ggccacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc
ctcaataagacagtgcacgatctgattggcgggctgcgtgagcagtgctcttag

DBGET integrated database retrieval system