Mus pahari (shrew mouse): 110314416 Help Entry 110314416         CDS       T05929                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110314416  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110314416  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110314416   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110314416  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110314416   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110314416    04147 Exosome [BR:mpah04147]     110314416 Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110314416 Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110314416 Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110314416 BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110314416 NCBI-ProteinID:  XP_021044447 LinkDB All DBs Position X:82155884..82156345 Genome browser AA seq 153 aa AA seqDB search MQSIEDVSQEIWQDCIKMCLQYEICNDAAIITNSPPWLLASPPEGNFLQITQEEIQTLLA REGREKLFLQGVTLAGIRCLLIRDNLFTQGNNSMDLRTKGQSRGSQAVTIVQMESVYLVV MGKKGTEGGPLNLKAFEIAGYMREAILQNMARS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagagtatcgaggatgtcagccaagaaatctggcaagattgtatcaaaatgtgccta caatatgagatatgcaatgatgcagcaattatcaccaactctccaccatggttattagct tctcctcctgaaggaaactttcttcagatcacccaggaagaaattcagaccttactggca agagagggtagagaaaaactgtttctccagggagtcacccttgctggaatcagatgcctg ttgatccgagacaacttgttcacccaaggcaacaacagcatggacctccgtaccaaaggc caaagtcgaggtagccaggcagtgactatagttcagatggagtctgtgtatcttgtggtg atgggaaagaaggggacagaaggaggacctctcaacctcaaagcttttgagatcgcaggc tacatgagagaggccattcttcaaaacatggcccgttcctaa

Mus pahari (shrew mouse): 110320000 Help Entry 110320000         CDS       T05929                                  Symbol Pfn2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110320000 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110320000 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110320000 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110320000 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110320000 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110320000 (Pfn2)    04147 Exosome [BR:mpah04147]     110320000 (Pfn2) Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110320000 (Pfn2) Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110320000 (Pfn2) Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110320000 (Pfn2) BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110320000 NCBI-ProteinID:  XP_021051469 Ensembl:  MGP_PahariEiJ_G0026450 LinkDB All DBs Position 4:complement(50735118..50741270) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtagggaaagaccgggaaggcttcttt accaacggtttgactcttggagcaaagaagtgctctgtgatcagagatagtctatacgtg gacggtgactgcacaatggacatccggacaaagagtcaaggtggagagccaacatacaac gttgctgttggcagagccgggagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggcttgaataagaaggcgtactcaatggcaaagtacttgagagactctgggttc tag

Mus pahari (shrew mouse): 110324882 Help Entry 110324882         CDS       T05929                                  Symbol Pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110324882 (Pfn4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110324882 (Pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110324882 (Pfn4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110324882 (Pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110324882 (Pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110324882 (Pfn4)    04147 Exosome [BR:mpah04147]     110324882 (Pfn4) Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110324882 (Pfn4) Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110324882 (Pfn4) Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110324882 (Pfn4) BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110324882 NCBI-ProteinID:  XP_021058268 Ensembl:  MGP_PahariEiJ_G0029347 LinkDB All DBs Position 7:4034840..4045363 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKL GEYLRKRGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttgcaaaacttactgttagacaccctactggggacaaagcatgtggacagt gcagccctcatcaaactccaagaaaagactctgtgtgtgacatcaccaggatttagtgta atgccaagtgatgttcgaacacttttgaatggatttgccaaaaacccattattaacccga agggaagggttgtatttcaaggaaaaggattacaaatgtgtccgggcagatgactattct ctctatgctaagaatgaaaacactggtgtggtggtggtgaagaccaacatgtatcttgtg gtggcaacttacacagcaggcatgtatcctagtgtctgcgtggaagccacagagaagctg ggagagtatctaaggaaaaggggaaactaa

Mus pahari (shrew mouse): 110331523 Help Entry 110331523         CDS       T05929                                  Symbol Pfn1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110331523 (Pfn1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110331523 (Pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110331523 (Pfn1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110331523 (Pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110331523 (Pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110331523 (Pfn1)    04147 Exosome [BR:mpah04147]     110331523 (Pfn1) Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110331523 (Pfn1) Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110331523 (Pfn1) Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110331523 (Pfn1) BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110331523 NCBI-ProteinID:  XP_021067863 Ensembl:  MGP_PahariEiJ_G0017776 LinkDB All DBs Position 14:complement(38486942..38489708) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMATHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagctttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa gacggggaattcacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggccactcacctgcggcgttcccagtac tga

Mus pahari (shrew mouse): 110333988 Help Entry 110333988         CDS       T05929                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110333988 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110333988 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110333988 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110333988 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110333988 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110333988 (Pfn3)    04147 Exosome [BR:mpah04147]     110333988 (Pfn3) Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110333988 (Pfn3) Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110333988 (Pfn3) Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110333988 (Pfn3) BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110333988 NCBI-ProteinID:  XP_021071462 Ensembl:  MGP_PahariEiJ_G0019626 LinkDB All DBs Position 16:complement(58146254..58147073) Genome browser AA seq 137 aa AA seqDB search MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTVHDLIGGLREQCS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtgactggaagggctacatcagtgcggtgctgcgggatcagcgtatcgatgacgtg gctatcgtaggccactcggacaatcgctgtgtgtgggcatcgcggcctgggggtctgctg gcggccatctccccgcaggaggtgggtgtgctcaccgggccggaccggcacacctttctg cagacgggtctgagcgtggcaggccgccgctgctgcgttatccgtgactacctgctggcc gagggtgacggcgtactggatgcgcgcaccaaggggctggacgggcgtgcaatctgtgtg ggccacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc ctcaataagacagtgcacgatctgattggcgggctgcgtgagcagtgctcttag

DBGET integrated database retrieval system