KEGG   Mus pahari (shrew mouse): 110314435
Entry
110314435         CDS       T05929                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04360  Axon guidance
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110314435
   04371 Apelin signaling pathway
    110314435
   04071 Sphingolipid signaling pathway
    110314435
   04024 cAMP signaling pathway
    110314435
   04022 cGMP-PKG signaling pathway
    110314435
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110314435
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110314435
   04670 Leukocyte transendothelial migration
    110314435
   04062 Chemokine signaling pathway
    110314435
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110314435
   04915 Estrogen signaling pathway
    110314435
   04914 Progesterone-mediated oocyte maturation
    110314435
   04921 Oxytocin signaling pathway
    110314435
   04926 Relaxin signaling pathway
    110314435
   04935 Growth hormone synthesis, secretion and action
    110314435
   04928 Parathyroid hormone synthesis, secretion and action
    110314435
   04916 Melanogenesis
    110314435
   04924 Renin secretion
    110314435
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110314435
  09154 Digestive system
   04971 Gastric acid secretion
    110314435
  09156 Nervous system
   04724 Glutamatergic synapse
    110314435
   04727 GABAergic synapse
    110314435
   04725 Cholinergic synapse
    110314435
   04728 Dopaminergic synapse
    110314435
   04726 Serotonergic synapse
    110314435
   04730 Long-term depression
    110314435
   04723 Retrograde endocannabinoid signaling
    110314435
  09158 Development and regeneration
   04360 Axon guidance
    110314435
  09159 Environmental adaptation
   04713 Circadian entrainment
    110314435
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110314435
   05207 Chemical carcinogenesis - receptor activation
    110314435
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110314435
   05163 Human cytomegalovirus infection
    110314435
  09171 Infectious disease: bacterial
   05133 Pertussis
    110314435
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110314435
   05142 Chagas disease
    110314435
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110314435
  09165 Substance dependence
   05030 Cocaine addiction
    110314435
   05032 Morphine addiction
    110314435
   05034 Alcoholism
    110314435
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110314435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314435
   04031 GTP-binding proteins [BR:mpah04031]
    110314435
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314435
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110314435
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110314435
NCBI-ProteinID: XP_021044455
Ensembl: MGP_PahariEiJ_G0021748
LinkDB
Position
2
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacattgagcgctgaggacaaggcggccgtggagcgcagcaagatgatcgac
cgcaacctccgggaggacggcgagaaggcggcgcgggaggtcaagctgctgctgctgggt
gctggtgaatctggaaagagtacaattgtgaagcagatgaaaattatccacgaagccggc
tactcagaagaggagtgtaagcagtacaaggcagtggtctacagcaacaccatccagtcc
atcattgccatcattagagccatggggaggttgaaaatcgacttcggagactctgctcgg
gcggatgatgctcgccaacttttcgtgcttgctggggctgcagaagaaggttttatgact
gcagagctcgccggggtcataaagagactgtggaaagacagtggtgtacaagcctgcttc
aacagatcccgggagtaccagctgaatgattctgcagcgtactatctgaatgacttggac
agaatagcacaaccaaattacatcccaactcagcaggatgtcctcagaaccagagtgaag
acgactggaattgtggaaacccactttaccttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagaggtcagagcggaagaagtggattcactgctttgaaggagtgactgcc
atcatcttctgcgtggccctgagtgactatgacctggttcttgctgaagatgaagaaatg
aaccgtatgcacgaaagcatgaagctgttcgatagcatatgtaacaacaagtggtttaca
gatacatccatcatccttttcctgaacaagaaggacctctttgaagaaaaaatcaaaaag
agtcccctcacgatatgctatccagaatatgcaggctcaaacacatatgaagaagcggct
gcgtatattcagtgtcagtttgaagacctcaataaaaggaaggacacaaaggaaatctac
acccacttcacgtgcgccacagatacgaagaacgtgcagtttgtgttcgatgctgtaaca
gacgtcatcataaagaataacctaaaagactgtgggctcttctaa

KEGG   Mus pahari (shrew mouse): 110319821
Entry
110319821         CDS       T05929                                 

Gene name
Gnai3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04360  Axon guidance
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110319821 (Gnai3)
   04371 Apelin signaling pathway
    110319821 (Gnai3)
   04071 Sphingolipid signaling pathway
    110319821 (Gnai3)
   04024 cAMP signaling pathway
    110319821 (Gnai3)
   04022 cGMP-PKG signaling pathway
    110319821 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110319821 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110319821 (Gnai3)
   04670 Leukocyte transendothelial migration
    110319821 (Gnai3)
   04062 Chemokine signaling pathway
    110319821 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110319821 (Gnai3)
   04915 Estrogen signaling pathway
    110319821 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    110319821 (Gnai3)
   04921 Oxytocin signaling pathway
    110319821 (Gnai3)
   04926 Relaxin signaling pathway
    110319821 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    110319821 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    110319821 (Gnai3)
   04916 Melanogenesis
    110319821 (Gnai3)
   04924 Renin secretion
    110319821 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110319821 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    110319821 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110319821 (Gnai3)
   04727 GABAergic synapse
    110319821 (Gnai3)
   04725 Cholinergic synapse
    110319821 (Gnai3)
   04728 Dopaminergic synapse
    110319821 (Gnai3)
   04726 Serotonergic synapse
    110319821 (Gnai3)
   04730 Long-term depression
    110319821 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    110319821 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    110319821 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110319821 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319821 (Gnai3)
   05207 Chemical carcinogenesis - receptor activation
    110319821 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110319821 (Gnai3)
   05163 Human cytomegalovirus infection
    110319821 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110319821 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110319821 (Gnai3)
   05142 Chagas disease
    110319821 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110319821 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    110319821 (Gnai3)
   05032 Morphine addiction
    110319821 (Gnai3)
   05034 Alcoholism
    110319821 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110319821 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110319821 (Gnai3)
   04031 GTP-binding proteins [BR:mpah04031]
    110319821 (Gnai3)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110319821 (Gnai3)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110319821 (Gnai3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 110319821
NCBI-ProteinID: XP_021051093
Ensembl: MGP_PahariEiJ_G0026966
LinkDB
Position
4
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggc
gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggacggc
tattcagaggatgaatgtaaacagtataaagtagttgtctacagcaataccattcagtcc
atcattgcgatcatacgagccatgggacggttgaagattgactttggggacgctgccaga
gcagatgatgcgcgacagttatttgttttagctgggagtgctgaagaaggagtcatgact
tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtgcaagcatgcttt
agcaggtccagggaatatcagctcaatgattctgcttcatactacctaaatgatttggat
agaatatcccagaccaactacattccaactcaacaagatgttcttcggacaagagtgaag
actacaggcattgtggagacccacttcaccttcaaggaactctacttcaaaatgtttgat
gtaggtggccaaagatccgaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggatgaggaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctctttcttaataagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacatacgaagaggcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggaggtctac
actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttacg
gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

KEGG   Mus pahari (shrew mouse): 110327202
Entry
110327202         CDS       T05929                                 

Gene name
Gnai2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04360  Axon guidance
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110327202 (Gnai2)
   04371 Apelin signaling pathway
    110327202 (Gnai2)
   04071 Sphingolipid signaling pathway
    110327202 (Gnai2)
   04024 cAMP signaling pathway
    110327202 (Gnai2)
   04022 cGMP-PKG signaling pathway
    110327202 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110327202 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110327202 (Gnai2)
   04670 Leukocyte transendothelial migration
    110327202 (Gnai2)
   04062 Chemokine signaling pathway
    110327202 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110327202 (Gnai2)
   04915 Estrogen signaling pathway
    110327202 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    110327202 (Gnai2)
   04921 Oxytocin signaling pathway
    110327202 (Gnai2)
   04926 Relaxin signaling pathway
    110327202 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    110327202 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    110327202 (Gnai2)
   04916 Melanogenesis
    110327202 (Gnai2)
   04924 Renin secretion
    110327202 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110327202 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    110327202 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110327202 (Gnai2)
   04727 GABAergic synapse
    110327202 (Gnai2)
   04725 Cholinergic synapse
    110327202 (Gnai2)
   04728 Dopaminergic synapse
    110327202 (Gnai2)
   04726 Serotonergic synapse
    110327202 (Gnai2)
   04730 Long-term depression
    110327202 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    110327202 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    110327202 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110327202 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327202 (Gnai2)
   05207 Chemical carcinogenesis - receptor activation
    110327202 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110327202 (Gnai2)
   05163 Human cytomegalovirus infection
    110327202 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110327202 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110327202 (Gnai2)
   05142 Chagas disease
    110327202 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110327202 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    110327202 (Gnai2)
   05032 Morphine addiction
    110327202 (Gnai2)
   05034 Alcoholism
    110327202 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110327202 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110327202 (Gnai2)
   04031 GTP-binding proteins [BR:mpah04031]
    110327202 (Gnai2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110327202 (Gnai2)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110327202 (Gnai2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Other DBs
NCBI-GeneID: 110327202
NCBI-ProteinID: XP_021061639
Ensembl: MGP_PahariEiJ_G0015524
LinkDB
Position
10
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcagccgagcgctctaagatgatcgac
aagaacctgcgggaggacggcgagaaggcagcgcgggaggtgaagttgcttctgttaggt
gctggagaatcagggaagagcaccatcgtcaagcagatgaagatcatccatgaagatgga
tactcagaggaggagtgccggcagtaccgtgcagtggtctacagcaataccatccagtcc
atcatggccattgtgaaggctatgggcaacctgcagatcgactttgctgacccccagcgt
gcggatgatgccaggcagctgttcgccctgtcctgtgctgcagaggagcaagggatgctt
cctgaagacctgtctggcgtcatccggaggctctgggctgaccacggtgtgcaagcctgc
tttggccgctcccgggaataccagctcaatgactcagccgcttactacctgaatgacctg
gagcgcattgcacagagtgactacatccccacacagcaggatgtgctgcggacccgtgtg
aagaccacgggcatcgtggaaacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggtgtcacg
gccatcatcttctgtgtcgccttgagcgcctatgacttggtgctggctgaggatgaggag
atgaatcgcatgcatgagagcatgaagctgtttgacagcatctgcaacaacaagtggttc
acagacacctccatcatcctcttcctcaacaagaaggacctgtttgaagagaagatcaca
cagagccccctgaccatctgtttccctgagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagcaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacacacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgtttgatgccgtc
actgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

DBGET integrated database retrieval system