KEGG   Mus pahari (shrew mouse): 110314674
Entry
110314674         CDS       T05929                                 
Name
(RefSeq) patr class I histocompatibility antigen, A-2 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314674
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314674
   04145 Phagosome
    110314674
  09143 Cell growth and death
   04218 Cellular senescence
    110314674
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314674
   04612 Antigen processing and presentation
    110314674
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314674
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314674
   05170 Human immunodeficiency virus 1 infection
    110314674
   05168 Herpes simplex virus 1 infection
    110314674
   05163 Human cytomegalovirus infection
    110314674
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314674
   05169 Epstein-Barr virus infection
    110314674
   05165 Human papillomavirus infection
    110314674
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314674
   05330 Allograft rejection
    110314674
   05332 Graft-versus-host disease
    110314674
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314674
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314674
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314674
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314674
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314674
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 110314674
NCBI-ProteinID: XP_021044581
LinkDB
Position
Unknown
AA seq 330 aa
MEKPGPXXLLLLLVARDLTQYCTGSHWLLTFNIVILVPGMLDPQFIQLGYVDSTQFQVFD
SKEPNARMQPRAAWMKQEPPEYWEKETPKALGLSLSGRLILVYMVNYNNHKENDYHTLQE
VYGCNVENDGIFLGGRYRLTYYGYDSLILNEDLNSLTAKGIVGEKFKTRQEQGGMTESWR
TYLLGENMESLLRCLDLGKETLMHSGGPQTHVTHHVRSEGNVTLRCWALGFYPADITMTW
KRDGKNHTQDIELPDTRPACHGNFQKWEAMVVPSGEELRYTYHVHHEGLPEPLTQKWEPP
QTIPIIAVLISLVLGALVXGTVVIFLIWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagaagcctggaccctncnccctcctcctcctattggtggccagagacctgacccag
tattgtacaggctcacactggctgctgactttcaacattgtaattttggtgcctggcatg
ttggatccccagtttatacagcttggatatgtagattccacacagtttcaggtattcgac
agcaaagaaccaaatgcaaggatgcaacctcgggctgcttggatgaagcaggagccacct
gaatattgggagaaagagacaccaaaagcccttggcttgtcactgtcaggaagactaatt
cttgtgtacatggtgaattacaataatcacaaggagaatgactatcacaccctgcaggaa
gtatatggctgcaatgtggaaaatgatgggattttcctcggtggtcgctaccggctcacc
tactatggctatgattccttaatcctgaatgaagacctgaactctttgactgcaaagggc
atagtaggtgaaaaatttaagacacgccaggagcaaggaggcatgacagaaagttggagg
acttacctgctaggggagaatatggaaagccttcttagatgcctggaccttggaaaggag
accttgatgcactctggtggcccccaaacacatgtgacccaccatgtaagatcagaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctgacattaccatgacctgg
aagagagatgggaaaaaccacacccaggacatagagctgccagacaccaggcctgcatgt
catggaaacttccagaagtgggaagctatggtggttccttctggagaagagctgagatac
acataccatgtgcatcatgaagggttacctgagcctctcactcagaagtgggagcctcca
caaaccatccccatcatagcagttctcatcagcctggttcttggagctttggtgntagga
actgtggtgatttttctnatatggaagaaataa

KEGG   Mus pahari (shrew mouse): 110314692
Entry
110314692         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q7 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314692
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314692
   04145 Phagosome
    110314692
  09143 Cell growth and death
   04218 Cellular senescence
    110314692
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314692
   04612 Antigen processing and presentation
    110314692
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314692
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314692
   05170 Human immunodeficiency virus 1 infection
    110314692
   05168 Herpes simplex virus 1 infection
    110314692
   05163 Human cytomegalovirus infection
    110314692
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314692
   05169 Epstein-Barr virus infection
    110314692
   05165 Human papillomavirus infection
    110314692
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314692
   05330 Allograft rejection
    110314692
   05332 Graft-versus-host disease
    110314692
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314692
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314692
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314692
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314692
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314692
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314692
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig PsbX
Other DBs
NCBI-GeneID: 110314692
NCBI-ProteinID: XP_021044594
LinkDB
Position
Unknown
AA seq 338 aa
MEMPGHCSLVLLLVAVDLTQYCAGSHWLLTFNIVILEPGRLEPLFIQVGYVDSTQFQGFD
TKKPNARMQPRAAWMEQEPPEYWEKETAKAHGLSLSGRRILRYLMINNENGNDQRLNGCV
ADYHTLQEVYGCNMANDGSFLGSHYQLNYYGYDSLILNEDLNSWIAEGKVGEEFKKYQEQ
GGLTESWRTYLLGKCVESLLRCLDLGEEALMHSDAPRTHVTHHVRPEGNITLRCWALGFY
PADITMTWKRDGKIHTQDMELPDTRPGGDGTFQKLAAVVVPPGEVLRYTCHVHYEGLPEP
LTLKWGPPQTIPIKAILTSLVLGALVVITVVIFLIWKK
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggagatgcctggacactgcagcctcgtcctcttattggtggctgtagacctgacccag
tattgcgcaggctcacactggctgctgactttcaacattgtgattttggagcctggcagg
ttggagcccctgtttatacaggttggatatgtagactccacacagtttcagggatttgac
accaaaaaaccaaatgcaaggatgcaacctcgggctgcttggatggagcaggagccacct
gaatattgggagaaagagacagcaaaagcccatggcttatcactgtcaggaagacgaatt
cttaggtacctgatgataaataatgagaatggtaatgaccagaggctgaatgggtgtgtg
gcagactatcacaccctgcaggaagtatatggctgcaatatggcaaatgatgggagcttc
ctcggcagtcactaccagctcaactactatggctatgattctttaatcctgaatgaggac
ctgaactcttggattgcagagggcaaagtaggtgaagaattcaagaaataccaggagcaa
ggaggcctgacagaaagttggaggacttacctgctagggaagtgtgtggaaagccttctt
agatgcctggaccttggagaggaggccttgatgcactctgatgccccccgaacacatgtg
acccaccatgtaagacctgaagggaatatcaccctgaggtgctgggccctgggcttctac
ccagctgacatcacaatgacctggaagagggatgggaaaatccacacccaggacatggag
ctgccagacaccaggcctggaggggatggaaccttccagaagttggcagctgtggttgtt
cctcctggagaagtgctgagatacacatgccatgtgcactatgaagggttacctgagcca
ctcactctgaaatgggggcctccacaaaccatccccatcaaagcaattctcaccagcctg
gttcttggagctttggtggtgataactgtggtgatttttctgatatggaagaaataa

KEGG   Mus pahari (shrew mouse): 110314816
Entry
110314816         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314816
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314816
   04145 Phagosome
    110314816
  09143 Cell growth and death
   04218 Cellular senescence
    110314816
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314816
   04612 Antigen processing and presentation
    110314816
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314816
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314816
   05170 Human immunodeficiency virus 1 infection
    110314816
   05168 Herpes simplex virus 1 infection
    110314816
   05163 Human cytomegalovirus infection
    110314816
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314816
   05169 Epstein-Barr virus infection
    110314816
   05165 Human papillomavirus infection
    110314816
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314816
   05330 Allograft rejection
    110314816
   05332 Graft-versus-host disease
    110314816
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314816
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314816
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314816
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314816
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314816
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Psg1 Ilm1
Other DBs
NCBI-GeneID: 110314816
NCBI-ProteinID: XP_021044694
LinkDB
Position
Unknown
AA seq 342 aa
MKNFEFQPLLLLFMVTLAITKHPNGSHTLRYVFTLLSWPGHPEPELIFLSYVDETQIMGF
NSVSESQRMESRVPWMSDLSAEFWELATEDILKEHRFLNTIMRKLLKIYNDSMNGYHTIQ
ETYGCQVKERLSFSHAFMELVLDTHDYITLNEDLQTWRGVGKAAEIIKEEWEKINLAKIS
KSFLLGACVEGLLGYLDFGKTHLLRIDTPKIHMTNKIRPDRKITLRCWAFNFYPSEITLA
WKRDGSNQTHDMEMVETRPSGDGSFQKWAAVVVSSGEEHRYTCHANHEGLSEPVTLRWDP
PESTIPFMAMIISLVLGALLLGAMMAFLIWKRRTRGKKVSWS
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaagaactttgaattccagcctctccttctgttgttcatggtcaccttggccatcaca
aagcatccaaatggttcacacactctgaggtatgtattcaccctcctgtcatggcctggg
catccggagcccgaattaatctttctcagctatgtggatgaaacacagatcatgggattc
aacagtgtatcagagagtcagaggatggagagtcgggtaccatggatgagtgatctgagt
gcagagttttgggagttagcaacagaggatatactgaaagaacatcgcttcttgaataca
atcatgaggaaattgctcaagatctacaatgatagcatgaatggatatcacacgatccag
gaaacgtatggctgccaagtcaaggagagattgtccttcagtcatgctttcatggaatta
gtattagatacacatgattacatcacactgaatgaggatctgcagacatggagaggggtt
ggcaaggcagctgagataattaaggaagagtgggagaaaataaatttggcaaagatatcg
aagtctttcctgctgggcgcatgtgtggaggggctccttggatacctggactttgggaag
acgcatttgttgagaatagacacccctaaaatacacatgacaaataagatcagaccagat
aggaaaatcaccctgaggtgctgggccttcaacttctacccatctgaaatcaccctagcc
tggaagagggatggaagcaaccagacccatgacatggagatggtagagaccaggccttct
ggggatggaagtttccagaagtgggcagctgtggtggtctcttctggagaagagcataga
tatacatgccatgcaaatcatgaggggctgtctgagcctgtcaccctgagatgggatcct
cctgaatctaccatccccttcatggctatgattatttctctggttcttggggctctgctt
ctgggagcaatgatggcttttcttatatggaagaggaggactagaggtaagaaagtgtca
tggtcttaa

KEGG   Mus pahari (shrew mouse): 110314822
Entry
110314822         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, D-37 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314822
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314822
   04145 Phagosome
    110314822
  09143 Cell growth and death
   04218 Cellular senescence
    110314822
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314822
   04612 Antigen processing and presentation
    110314822
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314822
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314822
   05170 Human immunodeficiency virus 1 infection
    110314822
   05168 Herpes simplex virus 1 infection
    110314822
   05163 Human cytomegalovirus infection
    110314822
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314822
   05169 Epstein-Barr virus infection
    110314822
   05165 Human papillomavirus infection
    110314822
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314822
   05330 Allograft rejection
    110314822
   05332 Graft-versus-host disease
    110314822
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314822
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314822
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314822
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314822
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314822
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 110314822
NCBI-ProteinID: XP_021044698
LinkDB
Position
Unknown
AA seq 289 aa
EPQFIQVGYVDSIQFQGFNSKEPNARMQPRAAWMEQEPPEYWEKETAKALDLALSGRQIL
KXMMNENKKKKNEYHTLQEVYGCNVANDGSFLGGHYRLTYYGYDSLTLNEDLNSWTAEGK
IGEEFKKHQEQGGMTDSWRTYLLGECVESLLRCLDIGKETLLHSDAPRTHVTRHVRPEGK
VTLRCWALGFYPADITLTWKMDGKNHTQDMELPDTRPAGDGTLQMWAAVVVPSGEELRYT
CQVCHEGLPEPLTLKWEPPQTIPIIAVLISLVLGALVVGTVVIFLIWKK
NT seq 870 nt   +upstreamnt  +downstreamnt
gagccccagtttatacaggtcggatatgtagactccatacagtttcagggattcaacagc
aaagaaccaaatgcaaggatgcaacctcgggctgcttggatggagcaggagccacctgaa
tattgggagaaagagacagcaaaagcccttgacttggcactgtcagggagacaaattctt
aagtanatgatgaatgaaaataaaaagaagaagaatgaatatcacaccctgcaggaagtt
tatggctgcaatgtggcaaatgatgggagcttccttggtggtcactaccggctcacctac
tatggctatgattccttaaccctgaatgaagatctgaactcttggactgcagaaggtaaa
ataggtgaagaattcaagaaacaccaggagcaaggaggcatgacagacagttggaggact
tacctgctaggggagtgtgtggaaagccttcttagatgcctggacattggaaaagagacc
ttgctgcactctgatgccccccgaacacatgtgacccgccatgtaagacctgaaggtaag
gtcaccctgaggtgctgggccctgggcttttacccagctgatatcaccctgacctggaaa
atggatgggaaaaaccacacccaggacatggagctgccagacaccagacctgcaggggat
ggaaccttacagatgtgggcagctgtggtggttccttctggagaagagctgagatacaca
tgtcaagtgtgccatgaagggttacctgagcctctcactctgaaatgggagcctccacaa
accatccccatcatagcagttctcatcagcctggttcttggagctttggtggtgggaact
gtggtgatttttctgatatggaagaaataa

KEGG   Mus pahari (shrew mouse): 110314930
Entry
110314930         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314930
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314930
   04145 Phagosome
    110314930
  09143 Cell growth and death
   04218 Cellular senescence
    110314930
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314930
   04612 Antigen processing and presentation
    110314930
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314930
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314930
   05170 Human immunodeficiency virus 1 infection
    110314930
   05168 Herpes simplex virus 1 infection
    110314930
   05163 Human cytomegalovirus infection
    110314930
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314930
   05169 Epstein-Barr virus infection
    110314930
   05165 Human papillomavirus infection
    110314930
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314930
   05330 Allograft rejection
    110314930
   05332 Graft-versus-host disease
    110314930
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314930
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314930
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314930
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314930
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314930
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 110314930
NCBI-ProteinID: XP_021044777
LinkDB
Position
Unknown
AA seq 331 aa
MRNPGCCTLLLLLLVVMDLTQFCTGSHWLQTFNIVIWEPGIINPRFIHIGYVDSKQYQGF
DSKDPMAILKPRAAWMEQELSEYWNVETSSILDLSQIDRRILYFMVIKNKHSIDDYHTLQ
EVYGCNVANDGRFLSGHFRLTYYGYDYLTLNEDLSSWTAEGKGAEHMKSRWENASEAEKW
KTYLQGECVQRLLRCLDLGKETLMHSDAPQTYVTHHVRPEGNVTLRCWALGFYPADITMT
WKRDGNNHTQEMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEP
PQTIPIIAVLIGLVLGTLVVGTVVIFLVWRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatgttgcacactcctcctcctcctcttggtggtcatggacctaacc
cagttttgtacaggttcacactggctgcagactttcaacattgtgatttgggagcctggc
ataattaatccccggttcatccacattggctacgtagactctaaacagtatcagggattt
gacagcaaagatccaatggctattttgaaacctcgagctgcatggatggagcaggagcta
tctgaatattggaatgtggagacatcaagtattctggatttgtcacagatagatagacga
attctttacttcatggtgataaaaaataaacacagtatagacgattatcacaccctgcag
gaagtgtatggctgcaatgtggcaaatgatgggcgcttcctcagcggtcacttccggctt
acctactatggctatgattacttaaccctaaatgaggacctgagctcctggactgcagag
ggcaagggagctgaacacatgaagagcaggtgggagaatgcaagtgaggcagaaaagtgg
aagacttacctgcaaggggagtgtgtacaaaggcttcttagatgcctggaccttggaaag
gagaccttgatgcactctgatgccccccaaacatatgtgactcaccacgtaagacctgaa
gggaatgtcaccctgaggtgctgggctctgggcttctacccagctgacatcaccatgacc
tggaagagggatgggaataatcacacccaagaaatggagctgccagacaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgaga
tacacatgtcatgtgcaccatgaagggttacctgagcctctcactctgaaatgggagcct
ccacaaaccatccccatcatagcagttctcatcggcctggttcttggaactttggtggta
ggaactgtggtgatttttctggtgtggaggaaataa

KEGG   Mus pahari (shrew mouse): 110314994
Entry
110314994         CDS       T05929                                 
Name
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110314994
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110314994
   04145 Phagosome
    110314994
  09143 Cell growth and death
   04218 Cellular senescence
    110314994
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110314994
   04612 Antigen processing and presentation
    110314994
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110314994
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110314994
   05170 Human immunodeficiency virus 1 infection
    110314994
   05168 Herpes simplex virus 1 infection
    110314994
   05163 Human cytomegalovirus infection
    110314994
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314994
   05169 Epstein-Barr virus infection
    110314994
   05165 Human papillomavirus infection
    110314994
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110314994
   05330 Allograft rejection
    110314994
   05332 Graft-versus-host disease
    110314994
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110314994
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110314994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110314994
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110314994
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110314994
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110314994
SSDB
Motif
Pfam: MHC_I C1-set
Other DBs
NCBI-GeneID: 110314994
NCBI-ProteinID: XP_021044826
LinkDB
Position
Unknown
AA seq 347 aa
MRSRHESPQELVPQAEQVQVALEEWPESTKKDGRYTVLVGLHRKEKKMYPCKAVARKGAE
RIQARLSQPWPSIDLHSLHYFHYFHTALSCLWKHQCISVGYIDNMKFQRCDSFEEIPRMD
PRAPWMEKERPEYWKELKHKVKNIAQSVRANLWTLLYYYNQSEGGFHILQWMVSCEVGPD
MQLLGAHYQAAYDGSDYITVIEVLSSWTAMDMVSQIRKSKLDSADTAEYFRTYVEGECVE
MLHRFLWNGKETLXRADLPKAHLAHPGRPESDVTWRCWTLGFYHADITLTWQRDGEDPTQ
DLDLVETRPVAGGTFQKWAAVVVPSGEEQRYTCYVHHEVLTEPLALK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagatctagacatgaaagtcctcaggagcttgtccctcaggctgagcaggtacaggtg
gcactagaggagtggcctgaaagcacaaagaaggacggcaggtacactgtcttggtgggg
ctccatagaaaagagaagaagatgtatccctgcaaggctgttgctcgcaagggtgcagaa
aggatacaggctagactgagtcagccttggcccagcattgacttacattcactacactat
ttccactatttccacactgccctgtcatgcctttggaagcaccagtgtatttctgtgggc
tacattgacaacatgaagtttcagcgctgtgatagctttgaggagattccgaggatggat
ccacgtgcaccttggatggagaaggaaagaccagagtactggaaggagctgaaacacaag
gtcaagaacattgcacaaagtgtcagagcaaacctttggaccctgctatactactacaac
cagagtgaaggtggctttcacatcctgcagtggatggtttcctgcgaggtagggccagac
atgcagcttcttggagcccactatcaggctgcctatgatggctcggattacatcacggtg
attgaagtcctgagctcctggactgcaatggacatggtgtctcagatcaggaagagcaag
ttagattcagcagacacagcagaatacttcaggacctatgtggagggagagtgcgtggag
atgctccacagattcctgtggaatggcaaggagactctttagcgagcagatctcccaaag
gcacatttggcccatccgggtagacccgaaagtgatgttacctggaggtgctggaccttg
ggcttctaccatgctgatatcaccctgacctggcagagggatggagaggacccgacccag
gacttggaccttgtggagaccaggcctgtagcgggtggaaccttccagaagtgggcagct
gtggtggtgccttctggagaggagcagagatacacatgctatgtgcaccatgaggtgcta
acagagcctcttgccctgaaatag

KEGG   Mus pahari (shrew mouse): 110315033
Entry
110315033         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315033
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315033
   04145 Phagosome
    110315033
  09143 Cell growth and death
   04218 Cellular senescence
    110315033
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315033
   04612 Antigen processing and presentation
    110315033
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315033
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315033
   05170 Human immunodeficiency virus 1 infection
    110315033
   05168 Herpes simplex virus 1 infection
    110315033
   05163 Human cytomegalovirus infection
    110315033
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315033
   05169 Epstein-Barr virus infection
    110315033
   05165 Human papillomavirus infection
    110315033
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315033
   05330 Allograft rejection
    110315033
   05332 Graft-versus-host disease
    110315033
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315033
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315033
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315033
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315033
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315033
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 110315033
NCBI-ProteinID: XP_021044860
LinkDB
Position
Unknown
AA seq 330 aa
MRKPGPCSLLLLLVARDLTQYCAGSHWLQTFNIVISEPGVWEPQFIQVGYVDSIQFQGFN
SKEPNARMQPRAAWMEQEPPEYWEKETAKALDLAQSGRQILKYMMNETKRKKNDYHTLQE
VYGCNVANDGSFLGGRYRLTYYGYDSLILNEDLNSWTAEGKVGEKFKTHQEQGGLTESWR
TYLLGECVESLLRCLDLGKETLMHSDAPRTHVNHHVRPEGNVTLRCWALGFYPADITLTW
KMDGKNHTQDIELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPP
KTIPIIPILISLVLGALVVGTVMIFLIWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaagcctggaccctgcagcctcctcctcctattggtggccagagacctgacccag
tattgtgcaggctcacattggctgcagactttcaacattgtaatttcggagcctggcgtt
tgggaaccccagtttatacaggtcggatatgtagactccatacagtttcagggattcaac
agcaaagaaccaaatgcaaggatgcaacctcgggctgcttggatggagcaggagccacct
gaatattgggagaaagagacagcaaaagcccttgacttggcacagtcagggagacaaatt
cttaaatacatgatgaatgaaactaaaaggaagaagaatgactatcacaccctgcaggaa
gtttatggctgcaatgtggcaaatgatgggagcttcctcggcggtcgctaccggctcacc
tactatggctatgattccttaatcctgaatgaggacctgaactcttggactgcagagggt
aaagtaggtgaaaaattcaagacacaccaggagcaaggaggcctaacagaaagttggagg
acttacctgctaggggagtgtgtggaaagccttcttagatgcctggaccttggaaaggag
accttgatgcactctgatgccccccgaacacatgtgaaccaccatgtaagacctgaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccctgacctgg
aagatggatgggaaaaaccacacccaggacatagagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgagatac
acatgccatgtgcaccatgaagggttacctgagcctctcactctgaaatgggagcctcca
aaaaccatccccatcataccaattctcatcagcctggttcttggagctttggtggtggga
actgtgatgatttttctgatatggaagaaataa

KEGG   Mus pahari (shrew mouse): 110315071
Entry
110315071         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315071
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315071
   04145 Phagosome
    110315071
  09143 Cell growth and death
   04218 Cellular senescence
    110315071
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315071
   04612 Antigen processing and presentation
    110315071
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315071
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315071
   05170 Human immunodeficiency virus 1 infection
    110315071
   05168 Herpes simplex virus 1 infection
    110315071
   05163 Human cytomegalovirus infection
    110315071
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315071
   05169 Epstein-Barr virus infection
    110315071
   05165 Human papillomavirus infection
    110315071
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315071
   05330 Allograft rejection
    110315071
   05332 Graft-versus-host disease
    110315071
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315071
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315071
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315071
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315071
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315071
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110315071
NCBI-ProteinID: XP_021044888
LinkDB
Position
Unknown
AA seq 331 aa
MRNPGLFAVLCVLLVAIDLSQYCAGSHWLKTFITVIMEPGILEDRYIKVSYVDSIQYQGF
DSRSATAGMQPRVAWMKQELPEYWEKETAQALGNSLTGRQTLIYLVTENNNEKDDYHTLQ
ETFGCNVANDGSFLGGHYGVTYYGYDYIILNEDLNSWTTKGIVGEKFTPDRKEGSVTELW
RTYLEGECVERLLRCLDLGKATLLRSDAPRTHVTHKVTPEGNVTLRCWALGFYPADITLT
WKRDGKNHTQDMELPDTRPAGDGTFQKLAAVVVPPDEEMRYTCHVHHEGLPGPLTLKWEP
PQTIPIIAIVIGLVLGALVVGTVVIFLVWRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaaccctgggctcttcgctgtcctttgcgtcctattggtggccatagacctgtct
cagtattgtgcaggctcacactggctgaagactttcattactgtaattatggagcctggc
atattagaggaccggtacatcaaggtcagctatgtagactccatacagtatcagggattc
gacagcagatcagcaactgcagggatgcaacctcgagttgcttggatgaagcaggagtta
cctgaatattgggagaaagagacagcacaagccctgggcaactcactgacaggaagacaa
actcttatctacttggtgactgaaaataataatgagaaggatgactatcacaccctgcag
gaaacatttggctgcaatgtggcaaatgatgggagcttccttggtggtcactacggagtc
acctactatggctatgattacatcatcctgaatgaggacctgaattcttggactacaaag
ggaatagtaggtgaaaaatttactccagaccggaaggaaggaagcgtgacagaactttgg
aggacttaccttgaaggggagtgcgtggaaaggcttcttagatgcctggaccttggaaag
gcgaccttgctgcgctctgatgccccccgaacacatgtgacccacaaagtaacacctgaa
gggaatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccctgacc
tggaagagggatgggaaaaaccacacccaggacatggagctgccagacaccaggcctgca
ggggatggaaccttccagaagttggcagctgtggtagttcctcctgatgaagaaatgaga
tacacttgtcatgtgcaccatgaagggttacctgggcctctcactctgaaatgggagcct
ccacaaaccatccccatcatagcaattgtcattggcctggttcttggagctttggtggtg
ggaactgtggtgatttttctggtgtggaggaaataa

KEGG   Mus pahari (shrew mouse): 110315143
Entry
110315143         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-25 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315143
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315143
   04145 Phagosome
    110315143
  09143 Cell growth and death
   04218 Cellular senescence
    110315143
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315143
   04612 Antigen processing and presentation
    110315143
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315143
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315143
   05170 Human immunodeficiency virus 1 infection
    110315143
   05168 Herpes simplex virus 1 infection
    110315143
   05163 Human cytomegalovirus infection
    110315143
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315143
   05169 Epstein-Barr virus infection
    110315143
   05165 Human papillomavirus infection
    110315143
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315143
   05330 Allograft rejection
    110315143
   05332 Graft-versus-host disease
    110315143
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315143
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315143
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315143
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315143
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315143
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315143
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 Psg1
Other DBs
NCBI-GeneID: 110315143
NCBI-ProteinID: XP_021044933
LinkDB
Position
Unknown
AA seq 330 aa
MRNPGCCTLLLFLVVMNLTEYCAGSHWLQIFNIVILEPGIINSRFIHIGYVDSIQYQGFD
SKDPMAILKPRTAWMEQELPEYWNVETASILKLSQVDRRLLHFMVTKHEHRMDDYHTLQE
VYGCNVANDGRFLGGHFRLTYYGYDYLYLNEDLSAWTADGKAAEHVKSTWDNGGDAERWK
TYLQGVCTKRLLRYLVLGKEMLLRSDAPQTYVTHRVTPEGNVTLRCWALGFYPAGITMTW
KRDGINHTQDMELSDTRPAGDGTFQKLAAVVVTSGEELRYTCHVHHEGLPEPLTLKWEPP
HTIPIIAILISLVLGILVVGTVIIFLMWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaacccgggatgctgcacactcctcctcttcttggtggtcatgaacctgaccgag
tattgtgcaggctcgcactggctgcagattttcaacattgtgattttggagcctggcata
attaattcccggttcatccacattggctatgtagactctatacagtatcagggatttgac
agcaaagatccaatggctattttgaaacctcggactgcatggatggagcaggaactacct
gaatattggaatgtggagacagcaagtattctgaaattgtcacaggtagatagacgactt
cttcacttcatggtgacaaaacatgaacatagaatggacgattatcacaccctgcaggaa
gtgtatggctgcaatgtggctaatgatgggcgcttcctcggtggtcacttccggctcacc
tactatggctatgattacttatacctgaatgaggacctgagcgcctggactgcagatgga
aaggcagctgaacatgtgaagagcacttgggataatggaggtgatgcagaaaggtggaag
acttacctgcaaggggtgtgcacaaaaaggcttcttagatacctggtccttggaaaggag
atgttgctgcgctctgatgccccccaaacatatgtgacccaccgtgtaacacctgaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctggcatcaccatgacctgg
aagagggatgggatcaaccacacccaagacatggaactgtcagataccaggcctgcaggg
gatggaaccttccagaagttggcagctgtggtggttacatctggagaagagctgagatac
acatgtcatgtgcaccatgaagggttacctgagcctctcactctgaaatgggagcctcca
cacaccatccctatcatagcaattctcatcagcctggttcttggaattttggtggtggga
acggtgatcatttttctaatgtggaaaaaatga

KEGG   Mus pahari (shrew mouse): 110315275
Entry
110315275         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315275
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315275
   04145 Phagosome
    110315275
  09143 Cell growth and death
   04218 Cellular senescence
    110315275
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315275
   04612 Antigen processing and presentation
    110315275
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315275
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315275
   05170 Human immunodeficiency virus 1 infection
    110315275
   05168 Herpes simplex virus 1 infection
    110315275
   05163 Human cytomegalovirus infection
    110315275
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315275
   05169 Epstein-Barr virus infection
    110315275
   05165 Human papillomavirus infection
    110315275
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315275
   05330 Allograft rejection
    110315275
   05332 Graft-versus-host disease
    110315275
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315275
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315275
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315275
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315275
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315275
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 110315275
NCBI-ProteinID: XP_021045023
LinkDB
Position
Unknown
AA seq 204 aa
MRKPGPCSLLLLLVARDLTQYCAGSHWLQTFNIVISEPGMLELLFIQVGYIDSIQFQGFN
SKEPNARMQPQAAWMKEEPPEYWEKETAKALDLALSGRQILKYMVNEHNNKKNDYHTLQE
VYGYNVANDGSFLSPYQLTYYGYDSLILNEDLNSWTSEGKVGEKFKTYQEQGGLTESWRT
YLLGECIERLLRCLDLGKETLMHS
NT seq 613 nt   +upstreamnt  +downstreamnt
atgaggaaacctggaccctgcagcctcctcctcctattggtggccagagatctgacccag
tattgtgcaggctcacactggctgcagactttcaacattgtaatttcagagcctggcatg
ttggagctcctgtttatacaggtcggatatatagactccatacagtttcagggattcaac
agcaaagaaccaaatgcaaggatgcaacctcaggctgcttggatgaaggaggaaccacct
gaatattgggagaaagagacagcaaaagcccttgacttggcactatcagggagacaaatt
cttaagtacatggtgaatgaacacaacaacaagaagaatgactatcacaccctgcaggaa
gtatatggctacaatgtggcaaatgatgggagcttcctcagtccctaccagctcacctac
tatggctatgattccttaatcctgaatgaggacctgaactcttggacttcagagggcaaa
gtaggtgaaaaattcaagacataccaggagcaaggaggcttgactgaaagttggaggact
tacctgctaggggagtgcatagaaaggcttcttagatgcctggaccttggaaaggagacc
ttgatgcactctg

KEGG   Mus pahari (shrew mouse): 110315312
Entry
110315312         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-32 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315312
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315312
   04145 Phagosome
    110315312
  09143 Cell growth and death
   04218 Cellular senescence
    110315312
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315312
   04612 Antigen processing and presentation
    110315312
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315312
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315312
   05170 Human immunodeficiency virus 1 infection
    110315312
   05168 Herpes simplex virus 1 infection
    110315312
   05163 Human cytomegalovirus infection
    110315312
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315312
   05169 Epstein-Barr virus infection
    110315312
   05165 Human papillomavirus infection
    110315312
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315312
   05330 Allograft rejection
    110315312
   05332 Graft-versus-host disease
    110315312
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315312
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315312
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315312
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315312
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315312
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Psg1 C2-set_2 LapA_dom
Other DBs
NCBI-GeneID: 110315312
NCBI-ProteinID: XP_021045057
LinkDB
Position
Unknown
AA seq 352 aa
MKTFESQPLLLLFMVTLAITKHPNGSHTLRYLYTLLSWPGPLEPQLIFLSYVDDTEILGF
NSISENLGVESRAPWMDKQTANFWQEAKDDVLNEQYTLKEMMRNALYIYNYSIIGYHTIQ
KTYGCQVIHRKYFSHGFFELAFNLHDYITLNKDLKTWTVGGKASEILKEEWEKKKYATRL
KPYLQGSCVRSLLRYVTLGKNSLLRTDTPKIHLTHKTRPDRKITLRCWAFNFYPPEITLA
WKRDGSNQTQDMEVIENRPSGDGTFQKWAAVVVFSGEEHRYTCHANHEGLSEPITMRWAK
HEPPEPTIPFLAIVIALVLGALLMGSVMTFLIWKRRTRGKKESCSSFMYLWK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaagacctttgaatcccagcctctcctcctgctgttcatggtcaccttggccatcacg
aagcatccaaatggttcacacactctgagatatttatacaccctcctgtcatggcctggg
cctctggaaccccagttaatctttctcagctatgtggatgatacggagattttgggattc
aacagtatatcagagaatctgggggtggagagccgggcaccatggatggataagcagact
gcaaacttttggcaagaggcaaaggatgatgtcctgaatgaacaatataccttgaaagaa
atgatgaggaatgcgctatacatctacaattatagcatcattggatatcacacaatccag
aagacttatggctgtcaagtcattcacagaaagtacttcagtcacggcttctttgaatta
gcattcaatctccatgattacatcacactgaataaggatctgaagacatggacagtgggt
ggcaaggcaagtgagatccttaaggaagagtgggagaaaaaaaaatatgcaactcggttg
aagccttatctgcagggttcatgtgtgaggtcactccttcgatacgtgaccttagggaag
aacagtttgctgaggacagacacccctaaaatacacctgacccataagaccagaccagat
aggaaaatcaccctgaggtgctgggccttcaacttctacccacctgaaatcaccctagcc
tggaagagggatggaagcaaccagacccaggacatggaggtgatagagaacaggccttct
ggggatggaactttccagaagtgggcagctgtggtggtcttttctggagaagaacataga
tacacatgccatgctaatcatgaggggctgtctgagcccatcaccatgagatgggctaag
catgagcctcctgagcccaccattcccttcttggctattgttattgctttggttcttgga
gctctccttatgggatcagtgatgacttttcttatatggaagaggaggactagaggtaag
aaagagtcatgttcttcatttatgtatctatggaaataa

KEGG   Mus pahari (shrew mouse): 110315373
Entry
110315373         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-24 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315373
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315373
   04145 Phagosome
    110315373
  09143 Cell growth and death
   04218 Cellular senescence
    110315373
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315373
   04612 Antigen processing and presentation
    110315373
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315373
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315373
   05170 Human immunodeficiency virus 1 infection
    110315373
   05168 Herpes simplex virus 1 infection
    110315373
   05163 Human cytomegalovirus infection
    110315373
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315373
   05169 Epstein-Barr virus infection
    110315373
   05165 Human papillomavirus infection
    110315373
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315373
   05330 Allograft rejection
    110315373
   05332 Graft-versus-host disease
    110315373
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315373
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315373
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315373
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315373
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315373
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Rio2_N Ig_2
Other DBs
NCBI-GeneID: 110315373
NCBI-ProteinID: XP_021045109
LinkDB
Position
Unknown
AA seq 331 aa
MRNPGPCTLLLLLLVAMDLTQYCAGSHWLQTFNIVILEPGMLEPRFIQVSYVDSIQYQGF
DSKDPSAGMQPRAAWIELEPPEYWEKETSRVLELSQVQRQVLRLMVKKNGHRMDDYHTLQ
EVYGCNVANDGSFLGGHYRLTYYGYDYLTLNEDLSSWTAKGKGAEHAKSKWENAGEAKRR
KTYLQGECVQRLLRCLDLGKETLMHSDAPQTHVTHHVRPEGNVTLRCWALGFYPADITMT
WKRDGNNHTQEMELPETRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEP
PQTIPIIAILIGLVLGTLVVGTVVIFLVWRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaaccctggaccttgcacactcctgctcctcctcttggtggccatggacctgacc
cagtattgtgcaggatcacactggctgcagactttcaacattgtgattttggagcctggc
atgttggagccccggttcatccaggtcagctatgtagactccatacagtatcagggattt
gacagcaaagacccatctgcagggatgcaacctcgagctgcatggatagagctggagcca
cctgaatattgggaaaaggagacatcaagagttctggaattgtcacaggtacagagacaa
gttcttcggttaatggtgaaaaaaaatggacacagaatggacgattatcacaccctgcag
gaagtatatggctgcaatgtggcaaatgatgggagtttcctcggcggtcactaccggctc
acctactatggctatgattacttaaccctgaatgaggacctgagctcttggactgcaaag
ggcaagggagctgaacacgcaaagagcaagtgggagaatgcaggtgaagcaaaaaggagg
aagacttacctgcaaggggagtgtgtacaaaggcttcttagatgcctcgaccttggaaag
gagaccttgatgcactctgatgccccccaaacacatgtgactcaccatgtaagacctgaa
gggaatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccatgact
tggaagagggatgggaacaatcacacccaagaaatggagctgccagaaaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgaga
tacacatgtcatgtgcaccatgaagggttacctgagcctctcactctgaaatgggagcct
ccacaaaccatccccatcatagcaattctcatcggcctggttctcggaactttggtggta
ggaactgtggtgatttttctggtgtggaggaaataa

KEGG   Mus pahari (shrew mouse): 110315457
Entry
110315457         CDS       T05929                                 
Name
(RefSeq) class I histocompatibility antigen, Gogo-A*0501 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315457
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315457
   04145 Phagosome
    110315457
  09143 Cell growth and death
   04218 Cellular senescence
    110315457
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315457
   04612 Antigen processing and presentation
    110315457
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315457
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315457
   05170 Human immunodeficiency virus 1 infection
    110315457
   05168 Herpes simplex virus 1 infection
    110315457
   05163 Human cytomegalovirus infection
    110315457
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315457
   05169 Epstein-Barr virus infection
    110315457
   05165 Human papillomavirus infection
    110315457
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315457
   05330 Allograft rejection
    110315457
   05332 Graft-versus-host disease
    110315457
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315457
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315457
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315457
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315457
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315457
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 MHC_I_3 C2-set_2 LapA_dom MHC_II_beta Psg1 Cass2
Other DBs
NCBI-GeneID: 110315457
NCBI-ProteinID: XP_021045169
LinkDB
Position
Unknown
AA seq 344 aa
MKNFESYPLLLLLMVNLAITKHPNGLHTLRIEHTILSCPVLPEPQSIYVSYVDDTLIMGF
NSRSENQRVESRAPWMNGKTAEYWDVITENVQRDLNSLKNTMKKMLHIYNDSMTEYHTIQ
KRHGCQVKESIYFSHAFMELRFNNHDYIALNEDMKTFRAVGKAAEILKEQWNKENFEKAM
KSYLMDICVDMLLEYLNLGKTSLLRTDTPKIHVTHKIKPDRKITLRCWVFNFYPPEITLT
WQRDGSNETQDMEVIETRPSGDGTFQKWAAVVVSAGEEHKYTCHVNHEGLSQPITLRWGK
DPPQPIIPFMAMVVALVLGAVLMGSVMTFFIWKRRSRGKNGAGS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaagaactttgaatcctatcccctccttctgctactcatggtcaacttggccatcacg
aagcatccaaatggtttacacactctgcgtattgaacacaccatcctgtcatgtcctgtg
cttccggagccccagtcaatctatgtcagctatgtggatgatacactaatcatgggattc
aacagtagatcagagaatcagagggtagagagccgagcaccatggatgaatggaaaaact
gcagagtattgggatgtgataacagagaatgtccagcgtgacctgaattccctcaaaaac
acaatgaagaaaatgctccacatctacaatgatagcatgactgaatatcacacaatccag
aagaggcatggctgccaagtcaaggagagtatatacttcagtcatgccttcatggaatta
agattcaataaccatgactacatagcactgaatgaggatatgaagacattcagagcagtc
ggcaaggcagctgagatacttaaggaacagtggaataaagaaaattttgaaaaggcaatg
aagtcttacctgatggacatatgtgtggacatgctccttgaatacctgaaccttgggaag
acgagtttgctgagaacagacacccctaaaatccatgtgacccataagatcaagccagat
aggaaaatcaccctgaggtgctgggtcttcaacttctacccacctgaaatcaccttaacc
tggcagagggatggaagcaacgagacccaggatatggaagtgatagagaccaggccttct
ggggatggaactttccagaaatgggcagctgttgtggtctctgctggggaagaacataaa
tacacatgccatgtaaatcatgaggggctgtctcagcccatcaccttgagatggggtaag
gatcctcctcaacccatcatccccttcatggctatggttgttgctttggttcttggagct
gtacttatgggatcagtgatgactttttttatatggaagaggaggagtagaggtaagaat
ggggctgggtcttaa

KEGG   Mus pahari (shrew mouse): 110315468
Entry
110315468         CDS       T05929                                 
Name
(RefSeq) class I histocompatibility antigen, Gogo-B*0103 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315468
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315468
   04145 Phagosome
    110315468
  09143 Cell growth and death
   04218 Cellular senescence
    110315468
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315468
   04612 Antigen processing and presentation
    110315468
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315468
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315468
   05170 Human immunodeficiency virus 1 infection
    110315468
   05168 Herpes simplex virus 1 infection
    110315468
   05163 Human cytomegalovirus infection
    110315468
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315468
   05169 Epstein-Barr virus infection
    110315468
   05165 Human papillomavirus infection
    110315468
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315468
   05330 Allograft rejection
    110315468
   05332 Graft-versus-host disease
    110315468
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315468
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315468
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315468
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315468
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315468
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315468
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110315468
NCBI-ProteinID: XP_021045177
LinkDB
Position
Unknown
AA seq 338 aa
MGSSSNRALLHMVVVSLAVTQTGAGSHSLRYFHTAVSRPCRGEPQYISVGYVDDMQFQRC
DSIEEIPRMEPRAPWMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQ
WMVSCEVGPDMRLLGAHYQAAYDGSDYITLNEDLRTWTAVDMVSQITKSKFESAGTAEYF
RAYVEGECLELLHRFLQNGKEILQRADPPKAHVAYHPRPDGDVTLRCWALGFYPADIILT
WQRDGEDLTQDMELVETRPSGDGTFQKWAAVVVPSGEEQRYTCYVHHEGLPEPFALKWGR
SSQSSVVTVVIIASLVLLGSVLTIVVCKRRGAGKQNVD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggggtcctcaagcaaccgcgctctcctgcacatggtggtggtctctttggctgttacc
caaacaggtgctggctcacattcactgcgctatttccacactgctgtgtcacggccttgt
cgtggggagccccagtatatctctgtgggctacgtggacgacatgcagtttcagcgctgt
gatagcattgaggagattccgaggatggagccacgtgcaccttggatggagaaggaaaga
ccagagtactggaaggagctgaaactgaaggtcaagaacattgcacaaagtgccagagca
aaccttcggaccttgctccgctactacaaccagagtgaaggcggctctcacatcctgcag
tggatggtttcctgtgaggtagggccagacatgcgccttcttggagcccactatcaggct
gcgtatgatggctcggattacatcaccctgaatgaagacctgcgcacctggactgcagtg
gacatggtgtctcagatcacgaagagcaagttcgagtcagcaggcacagcagagtacttc
agggcctatgtggagggagagtgcctggagctgcttcacagattcctgcagaatggcaag
gagattcttcagcgagcagatcccccaaaggcacatgtggcctatcaccctagacctgac
ggtgatgtcaccttgagatgctgggccttgggcttctaccctgctgatatcatcctgacc
tggcagagggacggagaggacctgacccaggacatggagcttgtggagacgaggccttca
ggggatgggacattccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacatgctatgtgcaccatgaggggctacctgagccctttgccctgaaatggggaagg
tcttctcaatcatctgtcgtcaccgtggtcatcattgctagtctggttctcctgggaagt
gttctcactattgtggtgtgcaagaggaggggtgcaggtaagcaaaatgttgattga

KEGG   Mus pahari (shrew mouse): 110315518
Entry
110315518         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110315518
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110315518
   04145 Phagosome
    110315518
  09143 Cell growth and death
   04218 Cellular senescence
    110315518
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110315518
   04612 Antigen processing and presentation
    110315518
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110315518
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110315518
   05170 Human immunodeficiency virus 1 infection
    110315518
   05168 Herpes simplex virus 1 infection
    110315518
   05163 Human cytomegalovirus infection
    110315518
   05167 Kaposi sarcoma-associated herpesvirus infection
    110315518
   05169 Epstein-Barr virus infection
    110315518
   05165 Human papillomavirus infection
    110315518
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110315518
   05330 Allograft rejection
    110315518
   05332 Graft-versus-host disease
    110315518
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110315518
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110315518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110315518
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110315518
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110315518
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110315518
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 110315518
NCBI-ProteinID: XP_021045216
LinkDB
Position
Unknown
AA seq 270 aa
RQRKIIQVQYVDSTQFQGFDSKKPNATMQPRAAWMEQEPPEYWEKETAKALGLALSGRRI
LEYMVNDNQHKENDYHTLQEVYGCNVANDGSFLGGRYQLTYYGYESLILNEDLNSWTAKG
IVGEKFKEHQIQGGLTESWRTYLLGECVERLLRCLDLGKETLMHSDAPRTHVTHHVRPEG
NVTLRCWALGFYPADITMTWKRDGKNHTQDIELPDTRPAGDGTFQKWAAVVVPSGEELRY
TCHVXHEGLPEPLTLKWEPPQTIPIIAVLI
NT seq 813 nt   +upstreamnt  +downstreamnt
gcagacagcgcaagatcattcaggtgcaatatgtagactccacacagtttcagggatttg
acagcaaaaaaccaaatgcaacgatgcaacctcgggctgcttggatggagcaggagccac
ctgaatattgggagaaagagacagcaaaagcccttggcttggcactgtcaggaagacgaa
tacttgagtacatggtgaatgacaatcagcacaaggagaatgactatcacaccctgcagg
aagtatatggctgcaatgtggcaaatgatgggagcttcctcggcggtcgctaccagctca
cctactatggctatgaatccttaatcctaaatgaggacctgaactcttggactgcaaagg
gcatagtaggtgaaaaattcaaggaacaccagatacaaggagggctgacagaaagttgga
ggacttacctgctaggagagtgcgtggaaaggcttcttagatgcctggaccttggaaagg
agaccttgatgcactcagatgctccccgaacacatgtgacccaccatgtaagaccagaag
ggaatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcacnatgacct
ggaagagggatgggaaaaaccacacccaagacatagagctgccagacaccaggcctgcag
gggatggaaccttccaaaagtgggcagctgtggtggttccttctggagaagagctgagat
acacatgccatgtgcancatgaagggttacctgagcctctcactctgaaatgggagcctc
cacaaaccatccccatcatagcagttctcatca

KEGG   Mus pahari (shrew mouse): 110335754
Entry
110335754         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, A-24 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335754
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335754
   04145 Phagosome
    110335754
  09143 Cell growth and death
   04218 Cellular senescence
    110335754
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335754
   04612 Antigen processing and presentation
    110335754
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335754
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335754
   05170 Human immunodeficiency virus 1 infection
    110335754
   05168 Herpes simplex virus 1 infection
    110335754
   05163 Human cytomegalovirus infection
    110335754
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335754
   05169 Epstein-Barr virus infection
    110335754
   05165 Human papillomavirus infection
    110335754
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335754
   05330 Allograft rejection
    110335754
   05332 Graft-versus-host disease
    110335754
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335754
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335754
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335754
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335754
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335754
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 Psg1 LapA_dom
Other DBs
NCBI-GeneID: 110335754
NCBI-ProteinID: XP_021073753
Ensembl: MGP_PahariEiJ_G0020550
LinkDB
Position
18:complement(4652180..4654395)
AA seq 345 aa
MKTFESQPLLLLFMVTLAITKHPNGSHTLRYVYTLLSWPGPLEPQLIFLSYMDDIQIMGF
NSISENLGLKSRVPWMDKPIDVFWEEETDEVLKEKSILNEIMRNMLRIYNYSIIGYHTIQ
KTCGCQVMHSQNFSHGFFELAFNLHDYITLNEDLKTWTVVGKAGEMLKKVWEKTKYANQL
KFFLQVLCVNSLLRYLTFGKKSLPRIETPKIHLTHKTRPDRKITLRCWAFNFHPPEITLA
WKRDGSNQTQDMEVIENRPSGDGTFQKWAAVVVSSGEEHRYTCHVNHEGLSEAITMRWAK
HEPPEPTIPFLAIVIALVLGALLMGSVMTFLIWKRRTRGKKGSCS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaagacctttgaatcccagcctctcctcctgctgttcatggtcaccttggccatcacg
aagcatccaaatggttcacacactctgagatatgtatacaccctcctgtcatggcctggg
cctctggagccacagttaatctttctcagctatatggatgatatacagatcatgggattc
aacagtatatcagagaatctggggttgaagagccgggtaccatggatggataagccgatt
gacgtgttttgggaagaggaaacagatgaagtcctgaaagaaaaatctattttgaatgaa
ataatgaggaatatgctacgcatctacaattatagcataattggatatcacacaatccag
aagacttgtggctgccaagtcatgcacagtcagaacttcagtcatggcttctttgaatta
gcattcaatctccatgattacatcacactgaatgaggatctgaagacatggacagtggtt
ggcaaggcaggtgagatgcttaagaaagtgtgggagaaaacaaaatatgcaaaccagttg
aagtttttcctgcaggttttatgtgtgaactcactccttcgatacctgacctttgggaag
aagagtttgccgaggatagagacccctaaaatacacctgacccataagaccagaccagat
aggaaaatcaccctgaggtgctgggccttcaacttccacccacctgaaattaccctagcc
tggaagagggatggaagcaaccagacccaggacatggaggtgatagagaacaggccttct
ggggatggaactttccagaagtgggcagctgtggtggtctcttctggagaagagcataga
tacacatgccatgtaaatcatgaggggctgtctgaggccatcaccatgagatgggctaag
catgagcctcctgagcccaccattcccttcttggctattgttattgctttggttcttgga
gctctccttatgggatcagtgatgacttttcttatatggaagaggaggactagaggtaag
aaggggtcatgttcttaa

KEGG   Mus pahari (shrew mouse): 110335755
Entry
110335755         CDS       T05929                                 
Name
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-24 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335755
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335755
   04145 Phagosome
    110335755
  09143 Cell growth and death
   04218 Cellular senescence
    110335755
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335755
   04612 Antigen processing and presentation
    110335755
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335755
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335755
   05170 Human immunodeficiency virus 1 infection
    110335755
   05168 Herpes simplex virus 1 infection
    110335755
   05163 Human cytomegalovirus infection
    110335755
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335755
   05169 Epstein-Barr virus infection
    110335755
   05165 Human papillomavirus infection
    110335755
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335755
   05330 Allograft rejection
    110335755
   05332 Graft-versus-host disease
    110335755
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335755
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335755
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335755
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335755
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335755
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 110335755
NCBI-ProteinID: XP_021073754
Ensembl: MGP_PahariEiJ_G0020548
LinkDB
Position
18:complement(4200776..4202938)
AA seq 330 aa
MMNSGLYNFLLLLVAMDLTQYCAGSHCLQTFNIVILKPGMLEPRFIQVSYVDSIQYQGFD
SKEPTARMQPRAAWMEQEPPEYWEKETEQVLRLSLTNKRFLRFMMNYNEQNNEEYHTLQE
VFGCNVAKDGSFLSGHYRLTYYGYEFIILNEDLSSWTAQGQAAEILKKDWVNKGTAEGWR
TYLLGVCVERLLRCLDLGKETLLRSDAPQTHVTHQVTPEGNVTLRCWALGFYPADITMTW
KRDGNNHIQDLELPDTRPAGDGTFQKWAAVXVPSGEELKYTCHVHHEGLPEPLTLKWEPP
QTIPIIAILIGLVLGALVVGTVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgatgaactctggactctacaacttcctcctcctcttggtggccatggacctgacccag
tattgtgcaggatcacactgtctacagactttcaatattgtgattttgaagcctggtatg
ttggagccccggttcatccaggtcagctatgtagactccatacaatatcagggatttgac
agcaaagaaccaactgcaaggatgcaacctcgggctgcatggatggagcaggagccacct
gaatattgggagaaggagacagaacaagtcctacgtttgtcactgacaaacaaaagattt
cttaggttcatgatgaactacaatgaacagaacaatgaggaatatcacaccctgcaggaa
gtgtttggctgcaatgtggcaaaggatgggagcttcctcagtggtcactatcggctcacc
tactatggctatgagttcatcatactgaatgaggacctgagctcctggactgcacaggga
caggcagctgaaatcctgaagaaagactgggtgaataaaggtacagcagaaggctggagg
acttacctgctaggggtgtgcgtggaaaggcttcttagatgcctggaccttggaaaggag
acattgctgcgctctgatgctccccaaacacatgtgacccaccaagttacacctgaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccatgacctgg
aagagagatgggaacaaccacatccaagacttggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtgngggttccttctggagaagagctgaaatat
acatgccatgtgcaccatgaagggttacctgagcctcttactctgaaatgggagcctcca
caaaccatccccatcatagcaattctcatcggcttggttcttggagctttggtggtagga
actgtggtgatttttctggtgtggaagaaataa

KEGG   Mus pahari (shrew mouse): 110335756
Entry
110335756         CDS       T05929                                 
Name
(RefSeq) class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335756
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335756
   04145 Phagosome
    110335756
  09143 Cell growth and death
   04218 Cellular senescence
    110335756
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335756
   04612 Antigen processing and presentation
    110335756
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335756
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335756
   05170 Human immunodeficiency virus 1 infection
    110335756
   05168 Herpes simplex virus 1 infection
    110335756
   05163 Human cytomegalovirus infection
    110335756
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335756
   05169 Epstein-Barr virus infection
    110335756
   05165 Human papillomavirus infection
    110335756
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335756
   05330 Allograft rejection
    110335756
   05332 Graft-versus-host disease
    110335756
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335756
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335756
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335756
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335756
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335756
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3
Other DBs
NCBI-GeneID: 110335756
NCBI-ProteinID: XP_021073755
Ensembl: MGP_PahariEiJ_G0020549
LinkDB
Position
18:4479281..4482458
AA seq 341 aa
MKTSVTEAIFLLLQVLLAMTTDPDGTHFFGFFQTLFTLPWLPQPHFISVGFVDDIQFERF
NSRRDVQRTEHCAPWIDQKKPEYWKDNTDLVLSYFQNLTEILQRMLKIYNYSVTGYHTIQ
RRYGCYVLPRGYFRNGFFEVVFNDHDYIRLNEDLSTWTPVGKFAEILREEWDSSGFTQRV
KTYLELTCVDLLLTELEYGKEILLRTDTPKIHVIRKVRPDKKITLRCWAMKFYPAEITLT
WEKEESNHTPDMEVTETMPAGDGTFQKWAAVVVLSGEEHRYKCHVNHEGLPKSITMRWVP
PEPISFMHIVIVVVLGTLLMGAMMTFLIWKRRTRGKKGSRT
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaagacctctgttactgaggctatcttcctgctgctgcaggttctgctggccatgacc
accgatccagatggtacccacttttttggctttttccaaactctcttcaccttgccctgg
ctgcctcagccccacttcatcagtgttggctttgtggatgatatacagtttgagagattc
aacagcagaagagatgttcagaggacagagcactgtgcgccatggatagatcaaaagaag
ccagagtattggaaggataacacagacctcgttttgagctattttcagaatttaacagag
attctgcaaaggatgctcaaaatctacaactacagtgtaactggatatcacacaatccag
agaaggtatggctgctatgtcctgcctcgaggatatttcagaaatggattctttgaagta
gtcttcaatgaccatgattacatcagactgaatgaggacctaagcacttggaccccagtg
ggcaagtttgctgagattctcagagaagagtgggattcatcaggtttcacacaacgtgtg
aagacttacttggagttaacatgtgtggacttactcctcactgagctggagtatggaaag
gagattttgctgagaacagatacccccaaaatacatgtgatccgtaaggtcagacccgac
aagaaaatcactctgaggtgctgggccatgaaattttaccctgctgaaatcactctaacc
tgggaaaaagaagaaagcaatcacaccccagacatggaggtcacagagaccatgcctgca
ggggatggaaccttccagaagtgggcagctgttgtggtactttctggagaagaacataga
tacaaatgtcatgtgaatcatgaggggctgcctaagtccatcaccatgagatgggtgcct
cctgagcccatttcttttatgcatattgttattgttgtggttcttggaactctgcttatg
ggagccatgatgactttcctgatatggaagaggaggactagaggtaagaaagggtcaagg
acttag

KEGG   Mus pahari (shrew mouse): 110335839
Entry
110335839         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, D-B alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335839
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335839
   04145 Phagosome
    110335839
  09143 Cell growth and death
   04218 Cellular senescence
    110335839
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335839
   04612 Antigen processing and presentation
    110335839
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335839
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335839
   05170 Human immunodeficiency virus 1 infection
    110335839
   05168 Herpes simplex virus 1 infection
    110335839
   05163 Human cytomegalovirus infection
    110335839
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335839
   05169 Epstein-Barr virus infection
    110335839
   05165 Human papillomavirus infection
    110335839
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335839
   05330 Allograft rejection
    110335839
   05332 Graft-versus-host disease
    110335839
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335839
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335839
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335839
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335839
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335839
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 DUF624 Psg1
Other DBs
NCBI-GeneID: 110335839
NCBI-ProteinID: XP_021073881
LinkDB
Position
18:complement(3971542..3974517)
AA seq 365 aa
MGTLMGCPLLFLLLAVTLARTQAGKSSHSLRYFATAMSRPGLGEPRFTAVGYVDDRQFMR
FDSDSENPRAEPCKPWVEQMEPEYWEQETRKFKEHTQNFRTCLQNLLHLYNQSQEGSHTI
QDMHGCYVGPDSQFLHGHYQHAYDGHDYITLNEDLSSWTAADAVAQITQHKWEEAGVAEE
YKAYLEGTCVETLHRLLEESQHHSDPPKTHVTHHPRSEGDVTLRCWALGFYPADITLTWQ
LNGEDLTQNMELVETRPAGDGTFQKWASVVVPSGEEPGYTCHIHHEGLPEPLTLRWEPPP
SSDSNMVIIAVLVVLGAMAAIGAMVTFVMKKQRNTAFLLTGGKGGDYAPAGGSNSVQTST
SCLEA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggggacccttatgggttgccctctactgttcctgctgctggcagtcaccctggcccgg
acccaagcaggcaagagctcacactcgctgcggtatttcgccactgccatgtcccggccc
ggcctcggggagccccggttcaccgctgtgggttacgtggacgataggcagttcatgcgc
ttcgacagcgactccgagaatcccagggccgagccatgcaagccgtgggtggaacagatg
gagcccgaatattgggagcaggaaacccggaaattcaaggagcacacccagaatttccga
acttgccttcagaacctactccacctgtacaaccagagtcaggaaggttcccacactatc
caggatatgcacggatgctacgtgggaccagatagtcagttcctacacgggcactatcaa
catgcctacgatggccacgattacatcaccctgaacgaggacctgagctcctggaccgca
gcggatgcagtggctcagatcactcaacacaagtgggaggaggctggcgtggcagaggaa
tacaaggcctacctagagggcacgtgcgtggagacactccacagattattggaggaaagt
cagcatcactcagaccccccaaagacacatgtgacccatcaccccagatctgaaggtgat
gtcaccttgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcag
ttgaatggggaggacctgacccagaacatggagcttgtggagaccaggcctgcaggggat
ggaaccttccagaagtgggcatctgtggtggtgccttctggggaggagcctggatacaca
tgccatatacaccacgaggggctgcctgagcccctcaccctgagatgggagcctcctcca
tcctcggactctaacatggtaatcattgctgttctggttgtccttggagctatggccgcc
attggagctatggtgacttttgtgatgaagaagcagagaaacacagcttttcttctcact
ggtggaaaaggaggagactatgctccagctggaggcagcaacagtgtccagacctctacc
tcatgtctggaggcttga

KEGG   Mus pahari (shrew mouse): 110335840
Entry
110335840         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, D-37 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335840
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335840
   04145 Phagosome
    110335840
  09143 Cell growth and death
   04218 Cellular senescence
    110335840
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335840
   04612 Antigen processing and presentation
    110335840
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335840
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335840
   05170 Human immunodeficiency virus 1 infection
    110335840
   05168 Herpes simplex virus 1 infection
    110335840
   05163 Human cytomegalovirus infection
    110335840
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335840
   05169 Epstein-Barr virus infection
    110335840
   05165 Human papillomavirus infection
    110335840
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335840
   05330 Allograft rejection
    110335840
   05332 Graft-versus-host disease
    110335840
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335840
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335840
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335840
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335840
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335840
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Psg1 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110335840
NCBI-ProteinID: XP_021073883
Ensembl: MGP_PahariEiJ_G0020541
LinkDB
Position
18:complement(3955619..3958362)
AA seq 363 aa
MLPFAHLLHLLASATVLASATDLTQTSSHSLRYFHTAVSRPGLGEPRIIVVGYVDDRQFV
SFDSDAENPRMKPCVPWVNQEGPEYWEDETRKAKDMGRNFRVNLRTLLRYYNQSNDESHT
LQWMYGCDMGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTATDLASQFSKRKAEEVGEAH
QQRAYLQGPCVEWLQKYLQLGKEMLLRSDPPKTHVTHHPRSEGXVTLRCWALGFYPADIT
LTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVEHEGLPEPLTLRW
EPPPSTXSXMVIIAVLVVLGAVIIIVAVVCFVMKRRRHTGVRGSYAHVLGKKSFQTSDWP
PKA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgttaccttttgcccacctgctccatctgctggccagcgccacagtgctggccagcgcc
acagacctgacccagactagttcacactcgctgcggtatttccacaccgccgtgtcccgg
cccggcctcggggagccccggatcattgtcgttggctacgtggacgacaggcagttcgtg
agcttcgacagcgacgcggagaatccgaggatgaagccgtgcgtaccgtgggtaaatcag
gaggggccggagtattgggaggatgagactcggaaagccaaggacatggggagaaacttc
agagtgaacctgaggaccctgctccgctactacaatcagagtaacgacgaatctcacacg
ctgcagtggatgtatggctgcgacatggggcccgatgggcgcctgctccgcgggtattgt
caggaggcctacgatggccaggattatatctccctgaacgaggacctgcgctcctggacc
gcgactgacttggcctcacagttctctaagcgcaaggcagaggaggttggtgaggcccac
caacagagggcatacctgcaaggtccttgcgtggagtggctccagaaatacctacagctg
ggaaaggagatgctgctgcgctcagaccctccaaagacacatgtgacccatcaccccaga
tctgaaggtgangtcaccctgaggtgctgggccctgggcttctaccctgctgacatcacc
ctgacctggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccagg
cctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggag
cagaattacacatgccatgtggagcatgaggggctgcctgagcccctcaccctgagatgg
gagcctcctccatccactgnctcnancatggtnatcattgctgttctggttgtccttgga
gctgtgatcatcattgttgctgtggtgtgttttgtgatgaagaggaggagacacacaggt
gtaagaggaagctatgctcatgttctaggcaagaagagcttccagacctctgactggcct
ccgaaggcatga

KEGG   Mus pahari (shrew mouse): 110335841
Entry
110335841         CDS       T05929                                 
Name
(RefSeq) class I histocompatibility antigen, Non-RT1.A alpha-1 chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335841
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335841
   04145 Phagosome
    110335841
  09143 Cell growth and death
   04218 Cellular senescence
    110335841
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335841
   04612 Antigen processing and presentation
    110335841
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335841
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335841
   05170 Human immunodeficiency virus 1 infection
    110335841
   05168 Herpes simplex virus 1 infection
    110335841
   05163 Human cytomegalovirus infection
    110335841
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335841
   05169 Epstein-Barr virus infection
    110335841
   05165 Human papillomavirus infection
    110335841
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335841
   05330 Allograft rejection
    110335841
   05332 Graft-versus-host disease
    110335841
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335841
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335841
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335841
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335841
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335841
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 ig PTCRA
Other DBs
NCBI-GeneID: 110335841
NCBI-ProteinID: XP_021073884
Ensembl: MGP_PahariEiJ_G0020540
LinkDB
Position
18:complement(3939411..3946836)
AA seq 363 aa
MWALIFWLLNQPLDSKARSHSLHYCYSAMTEPAPGVPSFFASGFLDNQPFIHYDSRNMKA
EPCADWLRENPQYFALETQVFTNRMKIFQLSLRNIEQYYNSSGAQSQRADSFHQQAGPHT
LQFTYGCEMQDNRSTGYWQYGYDGRDYLTLDLDSMQYTAATFIAGYTKRKWENNEYWLEK
EKTYLEKECILWLQRYLTMGGENFTRTDPPKTIVTHHPRPEGDVTLRCWALGFYPADITL
TWQRDGEDLSQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLTKRDSLTWE
PLQLTTPMTGVCARGRCNPQATTLIVLLVFIFGMVPMFGLTCYRIQARRKNWSALSVPED
ERL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtgggctcttatcttctggctcctgaatcagcccctggacagcaaagcccgatcgcac
tctctgcactactgttactcagccatgactgaaccggccccaggagttccttcatttttc
gccagtggctttttagataaccagcccttcatccactatgacagtaggaacatgaaggca
gagccttgtgctgactggctgagggaaaacccacagtacttcgctctcgagacccaggtt
ttcaccaatcggatgaagattttccagttgagcctgagaaacattgagcaatactacaat
agctctggtgcccagagtcagagagcagatagcttccaccagcaagcaggccctcacacc
ctccagttcacatacggctgtgagatgcaggacaacaggagcacagggtactggcagtat
ggctacgatggcagggactacctgaccttggacttggactccatgcaatacacagcagcc
actttcattgctggctacaccaagcgcaagtgggaaaacaatgagtactggctggagaaa
gagaagacctacttggagaaggagtgcatcctatggctgcagagatacttaaccatggga
ggagagaactttacccgaactgaccctccaaagacaatagtgacccatcaccccagacct
gaaggagacgtcaccctgaggtgctgggccctgggtttctaccctgctgacatcaccctg
acctggcagagggatggagaggatctgtcccaggacacggagcttgtggagaccagacct
gcaggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcag
agatacacatgccatgtgcaacatgaagggctaaccaagcgcgacagtctgacatgggag
cctcttcagctcactacgcccatgacaggagtatgtgctagaggaagatgtaatcctcaa
gcaaccaccctgattgtccttctggtttttatctttggcatggtacctatgtttggactt
acctgctacagaattcaggccagaagaaagaattggtctgctctatctgttcctgaagat
gagaggctctag

KEGG   Mus pahari (shrew mouse): 110335989
Entry
110335989         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q9 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335989
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110335989
   04145 Phagosome
    110335989
  09143 Cell growth and death
   04218 Cellular senescence
    110335989
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110335989
   04612 Antigen processing and presentation
    110335989
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335989
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335989
   05170 Human immunodeficiency virus 1 infection
    110335989
   05168 Herpes simplex virus 1 infection
    110335989
   05163 Human cytomegalovirus infection
    110335989
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335989
   05169 Epstein-Barr virus infection
    110335989
   05165 Human papillomavirus infection
    110335989
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110335989
   05330 Allograft rejection
    110335989
   05332 Graft-versus-host disease
    110335989
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110335989
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110335989
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335989
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110335989
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110335989
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110335989
SSDB
Motif
Pfam: MHC_I MHC_I_3
Other DBs
NCBI-GeneID: 110335989
NCBI-ProteinID: XP_021074086
LinkDB
Position
18:complement(1866694..1888768)
AA seq 230 aa
MWAKALCTLLLLLAVALTLTETRAGSHSLRYFLTSVSRPGLGEPRYVEVGYVDNTQFVRF
DSDAENPRYEPRAPWVEQEGPEYWERHTRGAKGNEQSFRVNLRILLGYYNQSAGGSHTIQ
RMYGCDVGSDGGLLRGYNQFAYDGRDYIALNEDLKTWMAADMAAQITRRKWEQAGAAELR
RAYLEGTCVEWLRRYLERGKETLWDLGKKAWFSRVAQGNAGTYLARKCFF
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtgggcaaaggcgctgtgcacgctgctcctgctgctggcggtcgccctgaccctgact
gagacccgcgcgggctcacactcgctgcggtatttcctcacctccgtgtcccggcccggc
ctcggagagccccggtacgtggaagtcggctacgtggacaacacgcagttcgtgcgcttc
gacagcgacgcggagaatccgagatatgaaccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggagcggcatacacgaggcgccaagggcaatgagcagagtttccgagtg
aacctgcggatcctgctcggctactacaaccagagcgcgggcggctctcacacaatccag
aggatgtatggatgtgacgtggggtcggacgggggcctcctccgcgggtataatcagttc
gcctacgatggccgagattacattgccctgaacgaagacctgaaaacgtggatggcagca
gacatggcagcacagatcacccgacgcaagtgggagcaggctggtgctgcagagctaagg
agggcctacctggagggcacgtgcgtggagtggctccgcagatacctggagcgcgggaag
gagacactgtgggacctgggcaagaaggcttggttctccagagttgcccaaggcaatgct
ggtacctatctggccaggaaatgctttttctaa

KEGG   Mus pahari (shrew mouse): 110336005
Entry
110336005         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336005
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110336005
   04145 Phagosome
    110336005
  09143 Cell growth and death
   04218 Cellular senescence
    110336005
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110336005
   04612 Antigen processing and presentation
    110336005
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110336005
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336005
   05170 Human immunodeficiency virus 1 infection
    110336005
   05168 Herpes simplex virus 1 infection
    110336005
   05163 Human cytomegalovirus infection
    110336005
   05167 Kaposi sarcoma-associated herpesvirus infection
    110336005
   05169 Epstein-Barr virus infection
    110336005
   05165 Human papillomavirus infection
    110336005
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110336005
   05330 Allograft rejection
    110336005
   05332 Graft-versus-host disease
    110336005
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110336005
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110336005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336005
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110336005
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110336005
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110336005
SSDB
Motif
Pfam: MHC_I C1-set Mucin Ig_3 ETRAMP
Other DBs
NCBI-GeneID: 110336005
NCBI-ProteinID: XP_021074098
LinkDB
Position
18:complement(3960132..3966618)
AA seq 346 aa
MVWVLRAAVVCALLLQMDARPSWTGILLGSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQ
VLRFSSKEETPRMAPWLEQEGADYWEQQTYIVRTQGQLSESNLMTLARFYNKSVDDSHTL
QWLQGCDVEPDRHLCLWYNQLAYDSVDFPTLNQDPSSCTVGNNTVPQISRHLKGHCSDLL
QKYLEKGKERLLRSDPPKTHVTHHPRSEGEVTLRCWALGFYPADITLTWQLNGEGLPEPL
TLRWEPAWYQKPCIQIVAMVFFILFIICLCVVCICTKKNAGGRGRRDTQEAGRDSPQDAS
NTVKDDEHTAESIRGPTIHLRTENWKSQVLMDQLNYLPSDLHCGRH
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggtctgggtcctcagggccgctgtggtctgcgcccttctcctgcagatggatgcccgc
ccgtcctggactgggatccttttgggttcacactcgcttaggtatttctacaccgctgtg
tcccggcctggcctcggggagccctggttcataatcgttggctacgtggacgacatgcag
gtcctgcgattcagcagcaaggaggagactccgaggatggcaccctggctggagcaggag
ggggcagattactgggagcagcagacttatatagtcaggactcaaggacagctgtctgaa
agtaatctgatgaccctggctcgtttttacaacaagagcgtggacgactctcacacacta
cagtggctgcagggctgcgatgtggagccagataggcacctgtgtctctggtacaaccag
ctcgcctatgatagcgtggatttccccaccctgaaccaagacccgagttcctgtacagtg
gggaacaacactgtacctcagatctctcggcacctgaagggccactgctcagacctgctg
cagaaatacctggaaaaagggaaggagaggctgctgcgttcagaccctccaaagacacat
gtgacccatcaccccagatctgaaggtgaagtcaccctgaggtgctgggccctgggcttc
taccctgctgacatcaccctgacctggcagttgaatggggaggggctgcctgagcccctc
accctgagatgggagcccgcatggtaccaaaagccttgcattcagattgttgccatggtt
tttttcattttgttcatcatttgtctctgtgtggtttgcatatgcacgaagaagaatgca
ggtgggagaggaaggcgtgacacccaggaagcaggcagagacagtccccaagacgctagc
aatactgtcaaggatgatgagcacactgcggagtccatccgaggaccaacaatccaccta
agaactgaaaactggaaatctcaggttcttatggaccagctgaactatctgccatctgac
ttacactgtggcaggcattag

KEGG   Mus pahari (shrew mouse): 110336006
Entry
110336006         CDS       T05929                                 
Name
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336006
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110336006
   04145 Phagosome
    110336006
  09143 Cell growth and death
   04218 Cellular senescence
    110336006
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110336006
   04612 Antigen processing and presentation
    110336006
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110336006
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336006
   05170 Human immunodeficiency virus 1 infection
    110336006
   05168 Herpes simplex virus 1 infection
    110336006
   05163 Human cytomegalovirus infection
    110336006
   05167 Kaposi sarcoma-associated herpesvirus infection
    110336006
   05169 Epstein-Barr virus infection
    110336006
   05165 Human papillomavirus infection
    110336006
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110336006
   05330 Allograft rejection
    110336006
   05332 Graft-versus-host disease
    110336006
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110336006
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110336006
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336006
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110336006
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110336006
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110336006
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 110336006
NCBI-ProteinID: XP_021074100
LinkDB
Position
18:complement(4126759..4132176)
AA seq 414 aa
MARRTLLLLLATALARTQTPAVARPGPGKPRYMEAGYVDDTQFVRFDSDAENPRMEPRAP
WMEQEGPEYWELQTKVAKGHEKSFQVNLRTLLGYYNQSKGGSHTFQWMYGCDVGSDGSLL
RGYWQYAYDGRDYIAKNDDLKTWTAADPAALITQRKWEQADEAEHYKAYVESTCVEWLHR
YLELRKETLLRTDHPKTKVTHHPRPDGDVTLRCWALDFYPADITLTWQKDREDLTQDMEL
VETRPAGDGTFQKWAAVVVPSGEEQRYTCHVDHQGLPEPLILRWEPPQSIIFIRTIVGAV
LGAGAILGFIIGSIMRWMMKWKKGYPAAGAGSAYPGALETLRHVAVPEEDKNAEAEVKVD
SRKDLLSSSSCLPSGCLRSSDSQLSMTPVARMKPQLMLDAVAHTAALPCLQAWE
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcgcggcgcacgctgctcttgctgctggcgaccgccctggctcggacccagaccccc
gcggtggcccggcccggccccgggaagccccggtacatggaagccggctacgtggacgac
acgcagttcgtgcgcttcgacagcgacgcggagaatccgaggatggagccgcgggcgccg
tggatggagcaggaggggccggagtattgggagctacagacaaaagtcgcaaagggccat
gagaagagtttccaagtgaatctaaggaccctgcttggctactacaaccagagcaagggt
ggctctcacacgttccagtggatgtatggctgtgacgtggggtcggacgggagcctcctc
cgcgggtactggcagtatgcctacgacggccgcgattatatcgccaagaacgatgacctg
aaaacatggacggcggcggacccggcggcgctcatcacccaacgcaagtgggagcaggct
gatgaggcagagcattacaaggcctacgtggaaagcacctgcgtggagtggctccacaga
tacctggagctcaggaaggagacgctgctgcgcacagaccacccaaagacaaaagtgacc
catcatcccagacctgatggtgatgtcaccctgaggtgctgggccctggacttctaccct
gctgacatcaccctgacctggcagaaggatcgagaggacctgacccaagacatggagctt
gtggagaccaggcctgcaggggatgggaccttccagaagtgggcagctgtggtggtgcct
tctggagaggagcagagatacacatgccatgtggaccatcagggactgcctgagcccctc
atcctgagatgggaacctcctcagtccatcatcttcattagaaccattgttggtgctgtc
cttggagctggggccatcttaggttttatcattggtagtattatgaggtggatgatgaag
tggaagaaagggtatccagctgcaggagctggctctgcatacccaggagccctggagact
ctgagacatgtagctgtcccagaagaggataagaacgcagaagctgaggtcaaagttgac
agcagaaaggacctgctctcctcttcatcctgcctgccctctgggtgcctccgctcatct
gactcccagctctcaatgaccccagtggcaaggatgaagccacagcttatgctggatgct
gtggcccatactgctgccctgccatgcctgcaggcctgggagtga

KEGG   Mus pahari (shrew mouse): 110336017
Entry
110336017         CDS       T05929                                 
Name
(RefSeq) HLA class I histocompatibility antigen, alpha chain G-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336017
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110336017
   04145 Phagosome
    110336017
  09143 Cell growth and death
   04218 Cellular senescence
    110336017
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110336017
   04612 Antigen processing and presentation
    110336017
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110336017
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336017
   05170 Human immunodeficiency virus 1 infection
    110336017
   05168 Herpes simplex virus 1 infection
    110336017
   05163 Human cytomegalovirus infection
    110336017
   05167 Kaposi sarcoma-associated herpesvirus infection
    110336017
   05169 Epstein-Barr virus infection
    110336017
   05165 Human papillomavirus infection
    110336017
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110336017
   05330 Allograft rejection
    110336017
   05332 Graft-versus-host disease
    110336017
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110336017
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110336017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336017
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110336017
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110336017
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110336017
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2
Other DBs
NCBI-GeneID: 110336017
NCBI-ProteinID: XP_021074101
LinkDB
Position
18:complement(4960273..4983222)
AA seq 439 aa
MPARRLARSALVPDPKPPRFQPREPFHQGARRLLPPRCRALVAPPRERLHPGPRTLSPRS
TALLEARQSCPPQRSSSEPRRSPALSALLPLLLTGALALTQVCAGIHSLQFFATAVTQPG
LREHSFIFVGFVDDTQFLCYNSQGKSKRMEPRALWVKQMGPEYWKRQTKIVKDIEKNSLM
NLREAMSIYNHSEDGSHVFQCVSGCQVGPDGFFLRGHEEHAYDGRDYLALNQDLHSWVAG
DTTAQIALRKWEEAGVSEQRRSYLKGECVESLRTYLEIGKETLLRADPPKAHVTHHPRPE
GEVTLRCWALXFYPADIMLTWQRDEEDLTQDMDLIETRPAGDGTFQKWAAVVVPSGEEQR
YTCHVQHEALAQPLVLKWDPSKHTIPIMGITVGLVLLGVVFTGAVVAIVMRKRRGLQIII
LKTGLDSFCSSRSLRRLIE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccgcccgccggcttgcccgatctgccctggtcccagacccgaaacccccgaggttt
cagccacgtgagcctttccaccaaggagccaggcggcttctccctcccaggtgtcgggcc
ctcgtggctccaccgcgggagcggctccacccgggtccccgcacgctctcaccgcgctcg
acagcactacttgaggctcggcagtcctgccctccccaacgctcgtcttccgagccgagg
agaagccccgcgctctctgccctcctacccttgctgctcaccggagctttggccttgact
caggtttgcgcaggcatccattccttgcagttttttgccaccgccgtgacccagcctggt
ttgagggagcattccttcatctttgtcggtttcgtggatgacacacagttcttgtgctac
aacagtcaagggaaaagtaagagaatggagccgcgcgcgttgtgggtgaagcagatgggg
cccgagtattggaagaggcagaccaagatcgtcaaggacattgagaagaattccctaatg
aacttgcgggaggccatgagcatctacaaccacagcgaggatggctctcacgtctttcag
tgtgtgtctggctgccaagtggggccagatggattcttcctccgtgggcatgaggagcac
gcatacgacggccgcgattacctcgccctaaaccaggacctgcactcctgggtcgcaggc
gacacaacggcgcagatcgcgctgcgcaagtgggaggaggctggtgtctctgagcaaagg
cgatcctacttgaagggcgaatgtgtggagtcgctccgcacgtacctggagatagggaag
gagactctgctaagagcagatcctccgaaggcacatgtgacccatcaccccagacctgaa
ggtgaagtcaccctgaggtgctgggccctggncttctaccctgctgacatcatgctgacc
tggcagagggatgaggaggacctgacccaggacatggacctcattgagaccagacctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggaacagaga
tacacatgccatgtgcaacatgaggcactagcccagccccttgttctgaaatgggaccct
tctaagcataccattcccatcatgggaatcactgttggcctggttctccttggagttgtg
tttactggagctgtagttgccatagtgatgaggaagagaagaggtcttcagataataatt
ctaaaaacagggctggacagcttctgttcttcaaggtctctcaggagactcattgagtag

KEGG   Mus pahari (shrew mouse): 110336104
Entry
110336104         CDS       T05929                                 
Name
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, D-B alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04145  Phagosome
mpah04218  Cellular senescence
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04940  Type I diabetes mellitus
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05203  Viral carcinogenesis
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110336104
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110336104
   04145 Phagosome
    110336104
  09143 Cell growth and death
   04218 Cellular senescence
    110336104
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110336104
   04612 Antigen processing and presentation
    110336104
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110336104
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336104
   05170 Human immunodeficiency virus 1 infection
    110336104
   05168 Herpes simplex virus 1 infection
    110336104
   05163 Human cytomegalovirus infection
    110336104
   05167 Kaposi sarcoma-associated herpesvirus infection
    110336104
   05169 Epstein-Barr virus infection
    110336104
   05165 Human papillomavirus infection
    110336104
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110336104
   05330 Allograft rejection
    110336104
   05332 Graft-versus-host disease
    110336104
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110336104
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110336104
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336104
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110336104
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110336104
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110336104
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_C SP_C-Propep Psg1
Other DBs
NCBI-GeneID: 110336104
NCBI-ProteinID: XP_021074180
LinkDB
Position
18:complement(1905055..1908207)
AA seq 358 aa
MPCIPDGALELQKLLLLWATALSPTQNRAGSHSLRYLSTAISRPGLWEPRFISVGYVDDT
QFVRFDSDAENPRMEPRAQWMEQEGPEYWKRETQRAEGNEQWFRGSRGTLCARLRYYDQS
AGGSHTLQRFSGWDCGLDGRLLXGYVKFAYEGRDYIALNEDLKTWTPADLAALITQRKWE
QAGAAELSRAYLEDECMEWLHRYLERGKETLLLKGTPPKAHVTHHPRSEGDVTLRCWALG
FYPADITLTWQLNEEDLTQDMELVETRPTGDGTFQKWASVVVPLGKEQNYTCHVYHSGLP
EPLTLRWEPPPSTDSIMVIIAVLVVLGAVVIIGAVVDFVMKRRKHTGGKGGDYAPAPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgccctgtattccagacggagcattggagttgcaaaagctgctcctgctgtgggcgacc
gccctgtccccgacccagaaccgcgcaggctcacactcgctgcggtatctctccaccgcc
atttcccggccgggcctctgggagccccggttcatctctgtcggctacgtggacgacacg
cagttcgtgcgcttcgacagcgacgcggagaatccgaggatggagccgcgggcgcagtgg
atggagcaggaggggccggagtattggaagcgggagacacagagagccgagggcaatgaa
cagtggttccgagggagccgaggaacgctctgcgcacgcctgcgctactacgaccagagc
gcgggcggctctcacacacttcagcggttttctggctgggactgtgggttggacgggcgc
ctcctcnncgggtacgtgaagttcgcctacgagggccgcgattacatcgccctgaacgaa
gacctgaaaacgtggacgccggctgacctggcagcactgatcacccaacgcaagtgggag
caggctggtgctgcagagctaagcagggcctacctggaggacgagtgcatggagtggctc
cacagatacctggagcgcgggaaggagacactgctgctcaaaggtacccccccaaaggcc
catgtgacccatcaccccagatctgaaggtgatgtcaccctgaggtgctgggccctgggc
ttctaccctgctgacatcaccctgacctggcagttgaatgaggaggacctgacccaggac
atggagcttgtagagaccaggcctacaggggatggaaccttccagaagtgggcatctgtg
gtggtgcctcttgggaaggagcagaattacacatgccatgtgtatcatagtgggctgcct
gagcccctcaccctgagatgggagcctcctccatccactgactctatcatggtaatcatt
gctgttctggttgtccttggagctgtggtcatcattggagctgtggtggattttgtgatg
aagaggagaaaacatacaggtggaaaaggaggggactatgctcccgctccaggttag

DBGET integrated database retrieval system