KEGG   Mus pahari (shrew mouse): 110314747
Entry
110314747         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 3-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110314747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110314747
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110314747
SSDB
Motif
Pfam: BTB
Other DBs
NCBI-GeneID: 110314747
NCBI-ProteinID: XP_021044636
LinkDB
Position
Unknown
AA seq 233 aa
MAGDTEFKSWGYTQINVQKLCYKWTISNFSFSMGGIQKRVTSPVFSLEANEALSWCLRVY
PNGVDEESKDYLSVYLELLSYLEKPVRAKFEFWIINSEGEKYQSRKGSKVESFLQYEHRG
FKKFLLRGLLLCHQDWFLPEDQLTICCKVSIVGNIFHMPGQNLTPTIKDPRHLLTDDVWE
LWENSLFTDCCLLVAGHEFKAHKAILAARSPVFRAMFEHEMKETLKNPIEIHN
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcaggggacacggaattcaagagctggggctacacacagatcaatgttcagaaactc
tgctataagtggaccattagcaacttttcatttagcatggggggaattcagaaaagggtt
acaagcccagtgttctcattagaggccaatgaggcactgtcatggtgtttgagggtgtac
ccaaatggcgttgatgaagaaagcaaagattacctgtcagtttacctggagttgctcagc
tatctggagaaaccagttagggcaaagtttgagttctggatcataaattctgaaggagag
aaatatcaaagtaggaagggctccaaagtcgaaagctttctgcaatatgaacacagggga
ttcaaaaagtttctccttcgaggtctcctcctctgccatcaggactggtttctccctgaa
gaccagctcaccatatgctgcaaggtgagcattgttggaaacatatttcacatgcctgga
cagaacctgacacctacaatcaaggatccaaggcacctgttgacagatgatgtatgggag
ctatgggagaattccctcttcacagattgctgcctgttggtagctggccatgaattcaag
gctcacaaggccatcctagcagctcgatctccagttttcagggcgatgtttgaacatgaa
atgaaggagactctaaagaaccccattgagatccataac

KEGG   Mus pahari (shrew mouse): 110314748
Entry
110314748         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 5-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110314748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110314748
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110314748
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110314748
NCBI-ProteinID: XP_021044638
LinkDB
Position
Unknown
AA seq 367 aa
MSGDMEATGWGYTHISVHNXCHKWTISNFSFCMDGSREKITSPKFSMEASDKVEWCXRVH
PXGIXEESKDYLXVXLGLLXCQKSPIWAKXEFWITTSQGESYRRRKSTNVLSFEKNQYRG
FKKFILRDFLLSNPPWLFPEDQLTLCCKVSIVGAFFNTPGQNITPAITDPRHVLADDLGE
LWENSLLTDCCLFVAGQKFRAHKAILAARSPVFRAMFEHEMKERLTNRVDMEDLDPKVFK
EMMAFIYTGKVPSLQSHSMACDVLAAADRYGMEGLMVICEDALCRNLSVKNAAHTLILAD
LHSTEQLKTKTLDFIALHASEVSETSEWKSMEESHPHLVAEAFHFLASAQCSFLEPCICG
ILDTSAF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtcaggggacatggaagccacagggtggggatacacacatatcagtgttcacaacttn
tgccacaagtggaccattagcaacttttcattttgcatggatggaagtagggaaaagatt
acaagtccaaaattctcaatggaggccagtgacaaagtggaatggtgtttnagggtacac
ccaaanggaattnatgaagaaagcaaagattacctgncagtttncctggggttactccan
tgtcaaaagagtccaatttgggcaaagtnngagttctggatcacaacttcccaaggagag
agttatcgaagaaggaagagcacaaatgtccttagctttgaaaaaaaccaatacaggggg
ttcaaaaagtttatcctacgagatttcctcctctccaatccaccttggctcttccctgaa
gaccagcttaccctctgctgcaaggtgagcatagtaggagccttctttaacacacctgga
cagaacataacacctgcaatcacggatccaagacacgtgttggcagatgacctaggcgag
ctgtgggagaattccctgctcacagactgctgcctgtttgtagctggccaaaaattcagg
gctcacaaggccatcctagcagctcgctctccagttttcagagccatgtttgaacatgaa
atgaaggagagactaacaaaccgtgttgatatggaagacctggatcccaaagtcttcaag
gagatgatggccttcatttacactgggaaggtaccaagcctccagagccactccatggcc
tgtgatgtcctggcagctgctgacaggtatggcatggagggcttgatggttatatgtgag
gatgccctctgcaggaacctctctgtgaagaatgctgcacacactctcatcctggccgac
cttcacagcacagagcagctgaagactaagaccctggatttcattgcacttcatgcttct
gaggtctctgagacctcagagtggaagtccatggaggagtcacatccccacttggtggct
gaagcattccacttcctggcttctgcacagtgttcgttcttagagccgtgtatttgtggt
attcttgacacttctgccttctaa

KEGG   Mus pahari (shrew mouse): 110315023
Entry
110315023         CDS       T05929                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TD and POZ domain-containing protein 5-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315023
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315023
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315023
SSDB
Motif
Pfam: BTB BACK ANXA2R Fusion_F0
Other DBs
NCBI-GeneID: 110315023
NCBI-ProteinID: XP_021044854
LinkDB
Position
Unknown
AA seq 362 aa
MSEDMEANNWGYTHIKVKEFCYVWTISNFSLCMEGIRRRIKSPVFSLEASDEVTWCLRVY
PNGVDEVSKDYLSVFLELLSCLESPVWAKYEFWITTSQGEKYQCMKSINVARFQKYQYRG
FKKFILGDXLLSHPCRFLPENKLTICCKVSIVGTIFGMPGENITPAITDPRHLLTNDLSG
LWENSLFTDCCLLVAGQEFRAHKAILAARSPVFRAMFEQEMKEKLTSPTEIHDLDPKVFK
EMMDFIYTGKVSNLQSHLMTTGVLTAADKYGLEGLKVLCEDALSRNLSVENAAHTLILAD
LHSTEHLKTKALDFIALHASEVSETSGWKSMRESHPHLVDETFHFLAPAHSXFLDPSLKH
LK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtcagaggacatggaagccaacaactggggctacacacatatcaaggttaaggaattc
tgctacgtgtggaccattagcaacttttcactttgcatggagggaattaggagaaggatt
aaaagcccagtgttctcattagaggccagtgatgaagtgacatggtgtttgagagtatac
ccaaacggggttgatgaagtaagcaaagattatctgtcagttttcctggagctgctcagc
tgtctagagagcccagtttgggcaaagtatgagttctggatcacaacttcccaaggagag
aaatatcaatgtatgaagagcatcaatgtcgctaggtttcaaaaataccaatacagggga
ttcaaaaagttcatccttggagatnncctcctctctcatccatgtcggtttctccctgaa
aacaagctcaccatctgctgcaaggtgagcatagtaggaaccatctttggcatgcctgga
gagaacataacacctgcaatcacggatccaaggcacctgttgacaaatgacctctcgggg
ctgtgggagaattccctgttcacagactgctgcctgttggtagctggccaagaattcagg
gctcacaaggccatcctagcagctcgctctccagttttcagagccatgtttgaacaggaa
atgaaggagaaactaacaagtcccactgagatccatgacctggatcccaaagtctttaag
gagatgatggacttcatttacactgggaaggtgtcaaacctccaaagccacctcatgacc
actggtgtgctgacagctgctgacaagtatggcctggagggcctgaaggttctgtgtgag
gatgccctctccaggaacctttctgtggagaatgctgcccacactctcatcctggctgac
ctccacagcacagagcacctgaagactaaggccctggatttcattgcacttcatgcttct
gaggtctctgagacctcagggtggaagtcaatgagggagtcccatccccacttggtggat
gaaacattccacttcctggctcctgcgcacagtngcttcttggatccctcactcaaacac
ctaaagtga

KEGG   Mus pahari (shrew mouse): 110315025
Entry
110315025         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 3-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315025
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315025
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110315025
NCBI-ProteinID: XP_021044856
LinkDB
Position
Unknown
AA seq 365 aa
MAGDMEFKSWGYTQISVQKFCYKWTISNFSFSMGGIQKRITSPVFSLEANKEVAWCLRVY
PNGADEECKDYLSVYLELLSYLEKPVWAKFEFWIINSQGEKYQSRKSPNVESFLQYEHKG
FKRFLLRSLLLSHQSWFLPEDQLTICCKVSTVGNIFDMPEQNMTPAIKDPRHMLTDDLGA
LWENSLFTDCYLLVAGHEFRAHKAILAARSPVFRAMFXHEMKESLKNPTELQDLDLQVFK
EMMGFIYKGKAPHLHSHSMACDVLAAADKYDLEGLKVMCEEALCRNLSVKNAVHTLILAD
LHSTEKLKTQALDFIAVHASEVSETSEWKSMVESHPHLVAEAFHYLASALCPCLEPKVTS
GSNRL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcaggggacatggaatttaagagctggggctacacacagatcagtgttcagaaattc
tgctataagtggaccattagcaacttttcatttagcatgggaggaattcagaaaaggatt
acaagcccagtgttctcattagaggccaataaggaagtggcatggtgtttgagggtgtac
ccaaatggcgctgatgaagaatgcaaagattatctgtcagtttacctggagttgctcagc
tatctggagaaaccagtttgggcaaagtttgagttctggatcataaattcccaaggagag
aaatatcagagtaggaagagccccaatgtcgaaagctttctgcaatacgaacacaaggga
ttcaaaaggtttctccttcgaagtctcctcctctcccatcagagctggtttctccctgaa
gaccagctcaccatatgctgcaaggtgagcacagttggaaacatatttgacatgcctgaa
cagaacatgacccctgcaatcaaggatccaaggcacatgttgacagatgatctaggggcg
ctatgggagaattccctcttcacagactgctacctcttggtagctggccatgaattcagg
gctcacaaagccatcctagcagctcgatctccagttttcagagccatgtttgancatgaa
atgaaggagagtctaaagaaccccactgagctccaggacctggatctccaagtcttcaag
gagatgatgggtttcatctacaaggggaaggcaccacacctccacagccactccatggcc
tgtgatgtgctggcagctgctgacaagtatgacctggagggcctgaaggtcatgtgtgag
gaggctctctgcaggaacctctctgtgaagaatgctgtacacactctcatcctagctgac
ctccacagcacagagaagctgaagactcaggccctggatttcattgctgttcatgcctct
gaggtctctgagacctcagagtggaagtcaatggtggagtcccatccccacttggtggct
gaagcattccactacctggcttctgcactgtgtccttgcttggagcctaaagttacctca
ggatctaaccggctatga

KEGG   Mus pahari (shrew mouse): 110315153
Entry
110315153         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 5-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315153
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315153
SSDB
Motif
Pfam: BTB BACK BTB_2
Other DBs
NCBI-GeneID: 110315153
NCBI-ProteinID: XP_021044943
LinkDB
Position
Unknown
AA seq 255 aa
MKSTNVLRFQKNQYSGFKKFILRDFLLSNPPWLLPEDQLTLCCKVSIVGAFFNTPGQNIT
PAITDPRHMLADGLGELWENSLLTVCCLFVAGQKFRAHKAILAAPSPVFRAMFEHEMKER
LTNRVEIEDLDPEVFKEMMGFIYTGKVPNLHSHTMACDVLAAADRYGMEALMVICEDALS
RNLSVEKASHTLILADFHCRKHLKTKALDFIARHASEVSETSEWKSMEESHPHLVAEAFH
FLASAQFSWNPHSNT
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaagagcacaaatgtccttaggtttcaaaaaaaccaatacagtggattcaaaaagttt
atcttacgagatttcctcctctccaatccaccttggctcctccctgaagaccagcttacc
ctctgctgcaaggtgagcatagtaggagccttctttaacacacctggacagaacataaca
cctgcaatcacagatccaagacacatgttggcagatggcctaggcgagctgtgggagaat
tccctgctcacagtctgctgcctatttgtagctggccaaaaattcagggctcacaaggcc
atcctagcagctccctctccagttttcagagccatgtttgaacatgaaatgaaggagaga
ctaacaaaccgtgttgaaatcgaagacctggatcccgaagtcttcaaggagatgatgggc
ttcatttacactgggaaggtgccaaacctccacagtcacaccatggcctgtgatgtgctg
gcagctgctgacaggtatggcatggaggccttgatggtcatatgtgaggatgccctctcc
aggaacctctctgtggagaaagcttcacacactctcatcctggctgacttccattgcaga
aagcatctgaagactaaggccctggatttcattgcacgtcatgcttctgaggtctctgag
acctcagagtggaagtccatggaggagtcacatccccacttggtggctgaagcattccac
ttcctggcttctgcacagttttcttggaaccctcactcaaacacctaa

KEGG   Mus pahari (shrew mouse): 110315178
Entry
110315178         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 1-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315178
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315178
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315178
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110315178
NCBI-ProteinID: XP_021044961
LinkDB
Position
Unknown
AA seq 207 aa
MSEDMEFKKSRGSTQISVEKLCYKWTISNFSFCMGGVQRRITSPTFSSEVSGELLVDVAV
FEHEMKESLKNPIEIHNLNPQVFKEMMXFIYTGKAPHLHSHSMACDVMAAADKYDLEGLK
VMCEDALCRNLSVKNAAHTLILADLHSTEKLKTQALDFIALYASEVSETSXWKSMVESHP
HLVAEAFHSLASAPCPFLEPKVISGSN
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtcagaggacatggaattcaagaagagcaggggctccacacagatcagtgttgagaaa
ctctgctataagtggaccattagcaacttctcattttgcatggggggagttcagagaagg
attacaagcccaacattctcatcagaagtatctggagagctgcttgtggacgttgcagtg
tttgaacatgaaatgaaggagagtctaaagaaccccattgagatccataacctgaatccc
caagtcttcaaggagatgatggntttcatctacacggggaaggcaccacacctccacagc
cactccatggcctgtgatgtgatggcagctgctgacaagtatgacctggagggcctgaag
gtcatgtgtgaggatgccctctgcaggaacctctctgtgaagaatgctgcacacactctc
atcctggctgacctccacagcacagagaagctgaagacncaggccctggatttcattgcc
ctctatgcctctgaggtctctgagacctcagngtggaagtcaatggtggagtcccatccc
cacttggtggctgaagcattccactccctagcttctgcaccgtgtcctttcttggagcct
aaagtgatctcgggttctaactag

KEGG   Mus pahari (shrew mouse): 110315536
Entry
110315536         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 3-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315536
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315536
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315536
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110315536
NCBI-ProteinID: XP_021045227
LinkDB
Position
Unknown
AA seq 365 aa
MAGDTEFKSWGYTQINVQKFCYKWTISNFSFSMGGIQKRITSPVFSLEANEELAWCLMVY
PNGDDEESKDYLSVYLELLSYLESPVWAKFKFWIVNSKGEKYQSRKSSKVECFLQYEHRG
FKKFLHRGLLLSYQDWFLPEDQLTICCKVSIVGTICHMPGYNMVPAIKDPRNMLTDDVGE
LWENSLFTDCCLLVAGHEFKAHKAILAARSPVFRAMFEHEMKETLKNPIEIHNLNPHVFK
EMMVFIYTGKAPHLHSHSMASDVLAAADKYGLVGLKVMCEEALCRNLSVKNAAHTLILAD
LHSTEKLKTQALDFIAVHASEVSETSEWKSVVESHPHLVAEAFHSQASAQCPCLEPKVIS
GSNQL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcaggggacacggaattcaagagctggggctacacacagatcaatgttcagaaattc
tgctataagtggaccattagcaacttttcatttagcatggggggaattcagaaaaggatt
acaagcccagtgttctcattagaggccaatgaggaattggcatggtgtttgatggtatac
ccaaatggtgatgatgaagaaagtaaagattacctgtcagtttacctggagttgctcagc
tatctggagagcccagtttgggcaaagttcaagttctggatcgtaaattctaaaggagag
aaatatcaaagtagaaagagctccaaagtcgaatgctttctgcaatatgaacacagggga
ttcaaaaagtttctccatcgaggtctcctcctctcctatcaggactggtttctccctgaa
gaccagctcaccatctgctgcaaggtgagcatagttggaaccatatgtcacatgcctgga
tataacatggtgcctgcaatcaaggatccaaggaacatgttgacagatgatgtaggggag
ctatgggagaattccctcttcacagattgctgcctgttggtagctggccatgaattcaag
gctcacaaggccatcctagcagctcgatctccagttttcagggcgatgtttgaacatgaa
atgaaggagactctaaagaaccccattgagatccataacctaaatccccatgtcttcaag
gagatgatggttttcatctacacgggaaaggcaccacacctccacagccactccatggcc
agtgatgtgctggcagctgctgacaagtatggcctagtaggcctgaaggtcatgtgtgag
gaggctctctgcaggaacctctctgtgaagaatgctgcacacactctcatcctggctgac
ctccacagcacagagaagctgaagactcaggccctggatttcattgctgttcatgcctct
gaggtctctgagacctcagagtggaagtcagtggtggagtcccatccccacttggtggct
gaagcattccattcccaggcttctgcacagtgtccttgcttggagcctaaagtgatctca
ggatctaaccagctatga

KEGG   Mus pahari (shrew mouse): 110315761
Entry
110315761         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 4-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315761
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315761
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110315761
NCBI-ProteinID: XP_021045396
LinkDB
Position
Unknown
AA seq 370 aa
MSWKLEAKSWVEIQSNDKEFCYRWTISNFSFFVEEREEYITSPVFSSEDNDKMTWCLRVY
PTGVDEENKDYVSLYLILLSCEKSPVWAMFEVCILNGKGEKCNTKSIPSFSRILPHQPFG
FEKFIIRHSFLSPAQVLTPDDKLTLLCNVSILQDSFSIYGQKPRPAIKVPKCTLEVDLGK
MWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMFEHDMEASLKNRVEIHDLDPLVFE
EMMDFIYMGTAPLLYSYSMACDVLAAADKYGLEGLKVMCEDALCRDLSVENAAHTLILAD
LHSTEHLKTQALDFITVYASEVSKTSGWMSMRESHPHLVAQAFHSLASAQSVCWALPFKQ
LKWSLRPSQL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcatggaaactggaagccaagagctgggttgaaatacagagcaatgacaaggaattc
tgctataggtggaccattagcaacttctctttttttgtggaggaaagggaggaatatatt
acaagcccagtgttctcgtcagaggacaacgacaaaatgacatggtgtttgagagtatac
ccaaccggagttgatgaagaaaacaaagattacgtgtcactttatctgattttgctcagc
tgtgaaaagagcccagtttgggcaatgttcgaggtttgtatcttaaatggcaagggtgaa
aaatgcaatacaaaaagcatcccaagcttttctagaatactgccacaccagccctttgga
ttcgaaaagttcatcattcgacattccttcttgtctccagcccaagtgctaacaccagat
gacaaacttaccctcctctgcaatgtgagcatactccaagactcattcagcatttatgga
cagaaaccaagacctgcaatcaaggttccaaagtgcacattggaagttgacctaggcaag
atgtgggagaattccctcttcacagactgctgcctgttggtagctggccatgaattcagg
gctcacaaggccatcctggcagctcgctctccagttttcagagccatgtttgaacatgat
atggaggcgagcctaaagaaccgtgttgagatccatgacctggatcccctggtcttcgag
gagatgatggatttcatctacatggggacggcaccactcctctacagctactcaatggcc
tgtgatgtgttggcagctgctgacaagtatggcctagagggcttgaaggtcatgtgtgag
gatgccctctgcagggacctctctgtggagaatgctgcacacactctcatcctggctgac
ctccacagcacagagcatctgaagacgcaggccctggatttcattacagtttatgcttcc
gaggtctctaaaacctcagggtggatgtcaatgagggagtcacatccccacttggtggct
caagcattccactctctggcttctgcacagagtgtttgctgggccctccctttcaaacaa
cttaagtggtctttaagacctagtcagctatga

KEGG   Mus pahari (shrew mouse): 110315881
Entry
110315881         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 5-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110315881
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110315881
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110315881
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 110315881
NCBI-ProteinID: XP_021045476
LinkDB
Position
Unknown
AA seq 308 aa
MSGDMEATGWGYTHISVHNFCHKWTISNFSFCMDGIREKITSPNFSLEVSDKVEWCLRVH
PNGIDEERKDYLSVYLRLLHCQKSPVWTKYEFWITTSQGENYQRMKSTNVLSFQKNQYRG
FKKFILRDFLLSNPWLLPEDQLTLCSKVSIVGAFFNTPGQNITPVITDPRHVLADDLGEL
WENSLFTDCCLFVAGQKFRAHKAILAARSPVFRAMLEHEMKERLTNRVDIEDLDPKVFKE
MMAFIYTGKAPNLQSHSMACDVLAAADRYGMEALMVMCEDALSRNLSVENAAHTLILADF
HCRKHLKT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtcaggggacatggaagcaacagggtggggatacacacatatcagcgttcacaacttc
tgccacaagtggaccattagcaacttttcattttgcatggatggaataagggaaaagatt
acaagcccaaacttctcattggaggtcagtgacaaagtagaatggtgtttgagggtacac
ccaaatggaattgatgaagaaaggaaagattacctgtcagtttacctgaggttactccac
tgtcaaaagagcccagtttggacaaagtacgagttctggatcacaacttcccaaggagag
aattatcaaagaatgaagagcacaaatgtccttagctttcaaaaaaaccaatacaggggg
ttcaaaaagtttatcctacgagatttcctcctctccaatccttggctactccctgaagac
cagcttaccctctgctccaaggtgagcatagtaggagccttctttaacacacctggacag
aacataacacctgtaatcacggatccaagacatgtgttggcagatgacctaggcgagctg
tgggagaattccctcttcacagactgctgcctgtttgtagctggtcaaaaattcagggct
cacaaggccatcctagcagctcgctctccagttttcagagccatgttagaacatgaaatg
aaggagagattaacaaaccgtgttgatatcgaagacctggatcccaaagtcttcaaggag
atgatggccttcatttacactgggaaggcgccaaacctccagagccactccatggcctgt
gatgtgctggcagctgctgacaggtatggcatggaggccttgatggtcatgtgtgaggat
gccctctccaggaacctctctgtggagaatgctgcacacactctcatcctggctgacttc
cactgcagaaagcatctgaagacttag

KEGG   Mus pahari (shrew mouse): 110318345
Entry
110318345         CDS       T05929                                 

Gene name
Spopl
Definition
(RefSeq) speckle-type POZ protein-like isoform X1
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110318345 (Spopl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110318345 (Spopl)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110318345 (Spopl)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 110318345
NCBI-ProteinID: XP_021048987
Ensembl: MGP_PahariEiJ_G0024686
LinkDB
Position
3
AA seq 392 aa
MSREPTPPLLGDMSTSPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNDKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNVSGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCCFFVRGKEFKAHKSVLAARSPVFNAMFEHEMEECTKNR
VEINDLDPEVFKEMMRFVYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNNNQTTDIMETSGWKSMI
QSHPHLVAEAFRALASSQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtctcgggaacctactccacctctgcttggagatatgtctactagtcctgttgcagaa
agctggtgttacacacaggttaaagtagtgaaattttcctacatgtggactattaataac
ttcagtttttgtagagaagaaatgggtgaagtgttaaagagttcaacattttcttctggc
ccaaatgataaaatgaaatggtgcctgagggtaaacccaaagggattagatgatgaaagt
aaagactatttgtccttatatttgctcctagtcagctgcccaaaaagtgaggttcgagct
aaattcaaattctctcttctcaatgataaaagggaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtacaggggaaggactggggatttaaaaaattcattagaagggat
tttttgcttgatgaagctaatggtctccttccagatgacaagcttacattattctgtgag
gtgagtgtggtccaagattcagtaaatgtatcaggacatactaatacaaacactttgaag
gtgccggaatgtcgactagcagaagacttaggtaatctctgggaaaacacaagatttaca
gattgctgcttttttgtgagaggaaaagaattcaaagctcataagtctgtgcttgcagct
cgatccccagtttttaatgcaatgtttgaacatgaaatggaagaatgcacaaagaatcga
gtggaaataaatgatttagaccctgaggtttttaaagaaatgatgagatttgtttacaca
ggaaaagcaccgaatcttgagaaaatggctgacaacttgttggcagctgcagacaaatat
gcactggaacggctgaaggtcatgtgtgaagaagctttgtgtagtaacctctcagtagaa
aatgttgctgatacccttgtccttgcagatttgcacagtgcagaacagttgaaagcccag
gcaatagactttattaataggtgcagtgttcttcgacaacttgggtgtaaggatgggaaa
aactggaacaacaaccaaacaactgacataatggaaacatcagggtggaagtccatgatt
cagtctcatcctcatttagtggcagaagccttccgagcactagcatcttcacagtgtcca
cagtttggtattccacgcaaaaggttaaagcagtcttga

KEGG   Mus pahari (shrew mouse): 110320660
Entry
110320660         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 4-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110320660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110320660
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110320660
SSDB
Motif
Pfam: BTB BACK
Other DBs
NCBI-GeneID: 110320660
NCBI-ProteinID: XP_021052422
LinkDB
Position
4
AA seq 370 aa
MSGEPEAKSWDDTQSSEQKFCYRWTISNFSFFVEEREEYITSPVFSSEDNDKMTWCLRVY
PTGVDEENKDYVSLYLILLSCEKSPVWAKFEICILDGKGEKRNTERISSFSRILPHQPFG
FEKFIIRHSFLSPAQVLTPDDKLTLLCKVSVLQDSFSIYGQKPRPAIKVPKCTLEDDLGK
LWENSLFTDCCLLVAGCEFRAHKAILAARSPVFRAMFEHDMEASLKNHVELHDLDPQIFK
EMMYFIYTGMAPHLHSHSMACDMLAAADKYGLEGLKVMCEDALCRDLSVENAAHTLILAD
LHSTEHLKTQALDFITVYASEVSKTSGWMSMKESHPHLVAQAFHSLASTHRVFWALPSKQ
LKWSLRPSQL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcaggggaaccggaagccaagagctgggatgacacacagagcagtgaacagaaattc
tgctacaggtggaccattagcaacttctctttttttgttgaggagagggaggaatatatt
acaagcccagtgttctcgtcagaggacaacgacaaaatgacatggtgtttgagagtatac
ccaaccggagttgatgaagaaaacaaagattacgtgtcactttatctgattttgctcagc
tgtgaaaagagcccagtttgggcaaagttcgagatttgtatcttagatggcaagggtgaa
aaacgcaatacagaaaggatctcaagcttttctagaatactgccgcatcagccctttgga
ttcgaaaagttcattattcgacattccttcttgtctccagcccaagtgctaacaccagat
gacaaacttaccctcctctgcaaggtgagcgtactccaagactcattcagcatttatgga
cagaaaccaagacctgcaatcaaggttccaaagtgcacactggaagatgacctaggcaag
ctgtgggagaattccctcttcacagactgctgcctgttggtagctggctgtgaattcagg
gctcacaaggctatcctggcagctcgctctccagttttcagagccatgtttgaacatgat
atggaggcgagcctaaagaaccatgttgagctccatgacctggatccccaaatcttcaaa
gagatgatgtactttatctacacggggatggcaccacacctccacagccactcaatggcc
tgtgatatgctggcagctgctgacaagtatggcctagagggcttgaaggtcatgtgtgag
gatgccctctgcagggacctctctgtggagaatgctgcacacactctcatcctggctgac
ctccacagcacagagcatctgaagacgcaggccctggatttcattacagtttatgcttcc
gaggtctctaagacctcagggtggatgtcaatgaaggagtcacatccccacttggtggct
caagcattccactctctggcttctacacatcgtgttttttgggccctcccttccaaacaa
cttaagtggtctttaagacctagtcagctatga

KEGG   Mus pahari (shrew mouse): 110330610
Entry
110330610         CDS       T05929                                 

Definition
(RefSeq) TD and POZ domain-containing protein 5-like
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110330610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110330610
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110330610
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 110330610
NCBI-ProteinID: XP_021066508
LinkDB
Position
13
AA seq 360 aa
MSKDMEANNWGYTHIRVKEFCYVWTISNFSLCMERIRRRITNPVFSLEANDKVTWCLRLQ
PNGVDEVSEYYLSVFLELLSCPESPVWAKYEFWIATSQGEKYQCMTSINVTRFQKNQYRG
FKKFILGDFFLSYRCWFLPENKLALCYKVSVVGAIFGMPGENITPAIKHPKHLLTDDLGE
LWENSLFTYCCLLVAGHEFRAHKAILAAHSPVFRAMFEHEMEERLANPTEIHDLDPKVFK
EMMDFIYTGKASNLHSHSMATDVLTAAYKYGLEGLKVLCEDALSRNLSVENAAHTLILAD
LHSTVQLKTQALDFIALHASEVSETSGWKSMMESHPHLVDETCHFLAPAHSVSWSPHSNT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcaaaggacatggaagccaacaactggggctacacacatatcagggttaaggaattc
tgctacgtgtggaccatcagcaatttttcactttgcatggagagaattaggagaaggatt
acaaacccagtcttctcattagaggccaatgacaaagtgacatggtgtttgagactacag
ccaaatggggttgatgaagtaagtgaatattacctgtcagttttcctggagttgctcagc
tgtccagagagcccagtatgggcaaagtatgagttctggattgcaacttcccaaggagag
aaatatcaatgtatgacgagcatcaatgtcactaggtttcaaaaaaaccaatacagggga
ttcaaaaagttcatccttggagatttcttcctctcttatcgatgttggtttctccctgaa
aacaagctcgccctctgctacaaggtgagcgtagtaggagccatctttggcatgcctggg
gagaacataacacctgcaatcaagcatccaaagcacctgttgacagatgacctaggggag
ctgtgggagaattccctcttcacatactgctgcctgttggtagctggccatgaattcagg
gctcacaaagcaatcctagcagctcactctccagttttcagagccatgtttgaacatgaa
atggaggagagactagcaaaccccactgagatccatgacctggatcccaaagtctttaag
gagatgatggacttcatttacactgggaaggcatcaaacctccacagccactccatggcc
actgatgtgttgacagctgcttacaagtatggcctggagggcctgaaggttctgtgtgag
gatgccctctccaggaacctctctgtagagaatgctgcccacactctcatcctggctgac
ctccacagcacagtgcagctgaagactcaggccctggatttcattgcacttcatgcttct
gaggtctctgagacctcagggtggaagtcaatgatggagtctcatccccacttggtggat
gaaacatgtcacttcctggctcctgcacacagtgtttcttggagccctcactcaaacacc
taa

KEGG   Mus pahari (shrew mouse): 110331187
Entry
110331187         CDS       T05929                                 

Gene name
Spop
Definition
(RefSeq) speckle-type POZ protein isoform X1
  KO
K10523  speckle-type POZ protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110331187 (Spop)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110331187 (Spop)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110331187 (Spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 110331187
NCBI-ProteinID: XP_021067256
Ensembl: MGP_PahariEiJ_G0018136
LinkDB
Position
14
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggtcccgttgccgag
agctggtgctatacacagatcaaggtagtgaagttctcctacatgtggaccatcaataac
tttagtttttgccgggaggaaatgggtgaagtcataaaaagttcaactttctcatcagga
gccaatgataaactgaaatggtgtttgcgagtaaacccaaaagggctagatgaagaaagc
aaagattacctgtcgctttacctgttgttggtcagctgtccaaagagtgaagttcgggca
aagttcaagttctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcag
cgagcttataggttcgtgcaaggcaaagactggggattcaaaaaattcatccgtagagat
tttctcttggacgaggccaatgggcttctccctgatgacaagctcaccctcttctgtgag
gtgagtgtagtacaagactctgtcaatatttctgggcagaatactatgaacatggtaaag
gttcctgaatgccggttggcagatgagttaggagggctgtgggagaactctcgattcacg
gattgctgcttgtgtgtggctggtcaagaattccaggctcacaaggctatcttagcagct
cggtctccagttttcagtgccatgtttgaacatgaaatggaagagagcaaaaagaatcgg
gttgaaattaatgatgtggaacctgaagtgtttaaggagatgatgtgcttcatctacacg
gggaaggcaccaaaccttgacaaaatggctgatgatttgctggcagctgctgataagtac
gccctggagcgtctgaaggtcatgtgtgaggatgccctctgcagtaacctctctgtggag
aacgctgcagagattctcatcctggctgacctccacagcgcagatcagctgaaaacacag
gcagtggatttcatcaactatcatgcttcggatgtcttggagacttctgggtggaagtca
atggtggtgtcacatccccacttagtggcagaagcataccgctctctggcttcggcacag
tgccctttcctagggcccccacgcaaacgcctgaagcaatcctaa

DBGET integrated database retrieval system