KEGG   Mus pahari (shrew mouse): 110314840
Entry
110314840         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 10 isoform X1
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314840
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110314840
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110314840
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110314840
NCBI-ProteinID: XP_021044710
LinkDB
Position
Unknown
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETTAEEQPGEEDQAVSVSFGDPEGSSLQEECEA
LRDLVCYCRQRGCKGRERMNGTCRKGHLIYTLCCR
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgctcttgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactacagctgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggagaccctgaaggctcttctcttcaagaagaatgtgaagca
ttgagagatctggtatgctattgtagacaaagaggctgcaaaggaagagaacgcatgaat
gggacctgcagaaagggtcatttaatatacacgctctgctgccgctga

KEGG   Mus pahari (shrew mouse): 110314841
Entry
110314841         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 10-like isoform X1
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314841
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110314841
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110314841
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110314841
NCBI-ProteinID: XP_021044713
LinkDB
Position
Unknown
AA seq 93 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKAEEQPGEEDQAMSVSFGGPEGSALQEESLS
DLVCYCRERGCKGSERMNGICSKGHLLYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgtcctgctggccttccaggtccaggctgat
cccatccaaaacacagatgaagagactaaagctgaggagcagccaggggaagaggaccag
gctatgtctgtctcctttggaggcccagaaggctctgctcttcaagaagaatcattgagt
gatctggtatgctattgtagagaaagaggctgcaaaggaagtgaacgcatgaatggaatc
tgcagcaaaggtcatttattgtacacgctctgctgccgctga

KEGG   Mus pahari (shrew mouse): 110314843
Entry
110314843         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 10-like isoform X1
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314843
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110314843
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110314843
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110314843
NCBI-ProteinID: XP_021044715
LinkDB
Position
Unknown
AA seq 93 aa
MKTLVLLSVLVLLTFQVQADPIQNTDEETKAEEQPGEEDQAVSVSFGNPEGSSLQEESLR
DLVCYCRQRGCKGRERMNGTCRKGHLLYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgtccttgtcctgctgaccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggaaaccctgaaggctcttctcttcaagaagaatcattgaga
gatctggtatgctattgtagacaaagaggctgcaaaggaagagaacgcatgaatgggacc
tgcagaaagggtcatttattgtacacgctctgctgccgctga

KEGG   Mus pahari (shrew mouse): 110314844
Entry
110314844         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 5-like
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314844
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110314844
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110314844
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110314844
NCBI-ProteinID: XP_021044718
LinkDB
Position
Unknown
AA seq 93 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKAEEQLGEEDQDVSVSFGGQDGSALHEELSK
KLTCYCRKRGCNKRERVTGICRNLFFTYVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggagcagctaggggaagaggaccag
gatgtgtctgtctcctttggaggccaagatggctctgctcttcatgaagaattgtcaaaa
aagctgacatgctattgtagaaaaagaggctgcaataaaagagaacgtgttactgggatc
tgcagaaatctttttttcacctacgtgttctgttgcagctga

KEGG   Mus pahari (shrew mouse): 110314845
Entry
110314845         CDS       T05929                                 
Name
(RefSeq) alpha-defensin-related sequence 1-like
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314845
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110314845
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110314845
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 110314845
NCBI-ProteinID: XP_021044719
LinkDB
Position
Unknown
AA seq 112 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKAEEQPGEEDQAVSVSFGDPEGSALQDAAPR
RFPWCRKCRPCQKCPVCPTCPQCPKWPLCNEKQNKTAIATQAPNTHPKVCCS
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaagacactcgtcctcctctctgcccttgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggagaccctgaaggctctgctcttcaagatgcagccccaaga
aggttcccgtggtgccggaagtgccgaccgtgccagaagtgcccggtgtgcccgacgtgc
ccccagtgcccgaagtggccgttgtgcaatgaaaagcaaaataaaacagcaatcgccacc
caagctccaaatacacatcctaaagtctgctgcagctga

KEGG   Mus pahari (shrew mouse): 110315646
Entry
110315646         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 10-like isoform X1
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110315646
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110315646
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110315646
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110315646
NCBI-ProteinID: XP_021045309
LinkDB
Position
Unknown
AA seq 95 aa
MKTLVLLSALVLLTFQVQADPIQNTDEETKAEEQPGEEDQAVSVSFGELEGSALQEECES
LRDLVCYCRQRGCKGRERPNGTCRKGHLIYTLCCR
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgtcctgctgaccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggagaactggaaggctctgctcttcaagaagaatgtgagtcg
ttgagagatctggtatgctattgtagacaaagaggctgcaaaggaagagaacgcccgaat
gggacctgcagaaagggtcatttaatatacacgctctgctgccgctga

KEGG   Mus pahari (shrew mouse): 110315647
Entry
110315647         CDS       T05929                                 
Name
(RefSeq) alpha-defensin 24-like isoform X1
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110315647
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110315647
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110315647
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 110315647
NCBI-ProteinID: XP_021045312
LinkDB
Position
Unknown
AA seq 93 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKAEDQPGEEDQAVSVSFGDPEGSALQEESLR
DLVCYCRQRGCKGRERMNGRCSHGYLLYMLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtccttctctctgcccttgtccttctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggaccagccaggggaagaggaccag
gctgtgtctgtctcctttggagaccctgaaggctctgctcttcaagaagaatcgttgaga
gatctggtatgctattgtagacaaagaggttgcaaaggaagagaacgcatgaatggaagg
tgcagccatggttatttattgtacatgctctgctgccgctga

KEGG   Mus pahari (shrew mouse): 110315648
Entry
110315648         CDS       T05929                                 
Name
(RefSeq) alpha-defensin-related sequence 1-like
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110315648
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110315648
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110315648
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 110315648
NCBI-ProteinID: XP_021045314
LinkDB
Position
Unknown
AA seq 110 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKAEEQPGEEDQAVSVSFGEPEGSALQDAAPR
RFPWCRKCRPCQKCPVCPTCPECPKRPSCSERQNKTAITTQAPNTTHKGC
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaagacacttgtgctcctctctgcccttgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaagctgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggagaacctgaaggctctgctcttcaagatgcagccccaaga
aggttcccgtggtgccggaagtgccgaccatgccagaagtgccccgtgtgcccgacgtgc
cccgagtgcccgaagaggccatcgtgcagtgaaaggcaaaataaaaccgcaatcaccacc
caagctccaaatacaactcataaaggctgttga

KEGG   Mus pahari (shrew mouse): 110336973
Entry
110336973         CDS       T05929                                 
Name
(RefSeq) alpha-defensin-related sequence 2-like
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110336973
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110336973
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110336973
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 110336973
NCBI-ProteinID: XP_021075371
Ensembl: MGP_PahariEiJ_G0021345
LinkDB
Position
19:complement(38960443..38961510)
AA seq 91 aa
MKTLVLLSALVLMAFYVQVDPTQETYEETKTEEQPGEEDQGVSVSSGVPERYVLDVAGQE
WPPQCPKCPVCLKCPQCPQCPGCPRCNCMTK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagacactagttctcctctctgcccttgtcctgatggccttctacgtccaggttgat
cctacccaagagacatatgaagagactaaaactgaggagcagccaggggaagaggatcag
ggtgtgtctgtgtcctccggagtcccagaacgctatgttcttgacgttgcaggccaagaa
tggcctccccagtgtccgaagtgcccagtgtgcttgaagtgcccacagtgcccacagtgc
cccgggtgcccgaggtgcaattgcatgacaaaatga

KEGG   Mus pahari (shrew mouse): 110337137
Entry
110337137         CDS       T05929                                 
Name
(RefSeq) neutrophil antibiotic peptide NP-2-like
  KO
K05230  defensin, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05150  Staphylococcus aureus infection
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110337137
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110337137
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110337137
SSDB
Motif
Pfam: Defensin_propep Defensin_1 DUF1280
Other DBs
NCBI-GeneID: 110337137
NCBI-ProteinID: XP_021075551
LinkDB
Position
19:39767803..39768602
AA seq 94 aa
MRMFTLLTILLLLALHTQAESPQGSTEEAPDQEQLVKEDQDISISFGGDKGAALLDADVK
SDLICYCKLIGCGFGERLSGACHYRGHVFRLCCR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaggatgttcactctgctcaccatccttctcttgctggccctgcacacccaggcagaa
tctccccaaggaagcactgaggaggctccggaccaggaacagttggtcaaggaggaccag
gatatttctatatcctttggaggggataaaggtgctgctctcctagatgcagatgtgaag
tcagacttgatctgctattgcaaactcataggctgtggttttggagaacggctctctggg
gcctgccattaccgtggccacgtcttccgactctgctgccgctga

DBGET integrated database retrieval system