KEGG   Mus pahari (shrew mouse): 110314998
Entry
110314998         CDS       T05929                                 
Name
(RefSeq) complement C1s subcomponent-like
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110314998
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110314998
  09171 Infectious disease: bacterial
   05133 Pertussis
    110314998
   05150 Staphylococcus aureus infection
    110314998
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110314998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110314998
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110314998
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     110314998
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110314998
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110314998
SSDB
Motif
Pfam: Trypsin Sushi FXa_inhibition EGF_CA Trypsin_2 EGF HRM
Other DBs
NCBI-GeneID: 110314998
NCBI-ProteinID: XP_021044829
LinkDB
Position
Unknown
AA seq 448 aa
MTGYRQAQSCTDNNSHDVNECTDFXDVPCSHFCNNYIGGYFCSCPPEYFLYDDMRNCGAI
PCPKEITANSFWEPKKAKYVFKDVVKITCVEGFEVVEGHVGSTSFYSTCQSDGQWSNSGL
KCQPVDCGIPDPIANGKVEEPEDTVFGSVIHYTCEEPYYYMEHEEGGQHHWMHLSLSCSY
SFLVCGVPTEPFQVKQRIFGGYPAKIQNFPWQVFINHPRAGGTLINEYWVLTAAHVVEKN
SNPSMYVGIMSLGIAHLENAQRLSIKRVIIHPGWKEREDLNPRTNFDNDIALVQLKDPVK
MGPNVSPICLPGTSSEYNLSQGDMGLISGWGRTEKRIHVINLRGAKVPVTSLETCKQVKE
QNPTARPEDYVFTDNMICAGENGVDSCNGDSGGAYAFQVPNVKVPKFYVAGLVSWGKKCG
AYGVYTKVKNYVDWILKTIQENSGPRKD
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgacaggatatcgacaggcacagtcttgtacagataacaacagccatgatgtgaatgaa
tgcacagattttncagatgtcccttgtagccacttctgcaataactacattggtggatac
ttctgctcctgtcccccagaatacttcctctacgatgacatgaggaattgtggagccatc
ccctgtcccaaagaaatcactgccaattctttctgggagcccaaaaaggcaaaatacgtt
tttaaagacgtggtgaagataacctgtgtggaaggatttgaagttgtggagggacatgtt
ggctcaacttcattctattctacttgtcaaagcgacggacagtggagcaactctgggcta
aaatgtcaacctgtggattgtggaattccagatcccattgcgaatggaaaagttgaagag
ccagaggatactgtgtttggttctgtcattcactacacgtgtgaagagccatattactac
atggaacatgaagaaggtggtcaacatcattggatgcatctctctctatcttgttcttat
tccttcctagtctgtggggtacccactgagccctttcaagtcaagcagaggatatttgga
ggataccctgcaaagattcaaaattttccctggcaagtctttattaatcaccccagagct
ggcgggactcttattaatgagtactgggtgctgacggccgctcacgttgtggagaaaaac
tccaacccttcaatgtatgtcgggatcatgtctttggggatagctcacttggaaaatgcc
cagaggctctccatcaagcgtgtaatcattcatcctggctggaaggaaagagaagaccta
aacccacggacaaattttgacaatgacattgccctggtgcagctgaaagaccccgtgaaa
atgggacccaacgtctcccccatctgcctaccaggcacctcctcagagtacaacctctca
cagggtgacatggggctgatctcagggtggggccgaacagaaaagagaatccatgttatc
aacctcagaggggcaaaggtaccagtaacctctttagaaacctgcaaacaggtgaaagag
cagaaccccacagcaaggccagaggactatgttttcactgacaacatgatctgtgctggc
gagaatggtgttgacagctgtaacggggacagcgggggcgcttatgctttccaggttccc
aatgtcaaggtccccaaattctatgtagctggcttggtgtcttgggggaaaaagtgtggg
gcctatggggtctacaccaaggtaaagaattatgtggactggatcctgaaaactattcag
gagaatagtgggcccaggaaggactaa

KEGG   Mus pahari (shrew mouse): 110316909
Entry
110316909         CDS       T05929                                 
Symbol
C1s
Name
(RefSeq) complement C1s subcomponent
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110316909 (C1s)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110316909 (C1s)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110316909 (C1s)
   05150 Staphylococcus aureus infection
    110316909 (C1s)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110316909 (C1s)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110316909 (C1s)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110316909 (C1s)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     110316909 (C1s)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110316909 (C1s)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110316909 (C1s)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 110316909
NCBI-ProteinID: XP_021046918
LinkDB
Position
2:complement(139658818..139769270)
AA seq 404 aa
MAASSTSFSEEKPVIKRETTPPVLKAAIPEEDLSVKTIAPPAIGADFVLFGKPQVSCVYX
PSQTPHLALSPQRVVTTLKCRMDAWRQNLESSSTGSSFPADSAKPVPLAVVSLDREXRCX
ANGSWVNDQLGIELPRCIPVCGVPTEPFQVKQRIFGGHPAKIQNFPWQVFINNPRAGGAL
INEYWVLTAAHVVEKNSNPLMYVGSTSVRTSSLDDAQSLYTERVIIHPGWKQVDDQNART
NFDNDIALVQLKDPVKMGPNVSPICLPGTSSEYNLSQGDMGLISGWGRTEKRFHVINLKG
AKVPVTSLETCKQVKDEKPRAGPEDYVFTDNMICAGENGVDSCNGDSGGAFAFQVPNVKV
PKFYVAGLVSWGKKCGTYGVYTKVKNYVDWILKTIQENSGPRKD
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctgctagctccacaagcttctctgaggagaagcctgtcataaaacgtgagaccact
ccaccagtgctgaaagcagccatacctgaggaggatctgtcagtaaagactattgcacct
ccagcaatcggggctgactttgtactctttgggaaaccacaggtgtcctgtgtgtacngc
cccagtcaaactccccacctggcactgtccccacagcgggttgtgaccaccctcaagtgc
aggatggacgcttggcgccagaatctagagtcaagctcaacagggtcttctttccccgct
gattccgccaagcccgttcccttggctgtggtttcgctggatagggagtancgctgcnct
gctaatgggagctgggtgaatgaccagctgggtattgagcttccaagatgtattccagtc
tgtggggtacccaccgagccctttcaagtcaagcagaggatatttggaggacaccctgca
aagattcaaaatttcccctggcaagtctttattaataaccccagagctggcggggctctt
attaatgagtactgggtgctgacggctgctcacgttgtggagaaaaactccaaccctttg
atgtatgttgggtccacgtctgtgaggacatcttccttggatgatgcccagagtctctac
accgagcgtgtgattattcatcctggctggaagcaagtagatgaccaaaatgcacggaca
aattttgacaatgacattgccctggtgcagctgaaagaccccgtgaaaatgggacccaac
gtctcccccatctgcctaccaggcacctcctcagagtacaacctctcacagggtgacatg
gggctgatctcagggtggggccgaacagaaaagagattccatgttatcaacctcaaaggg
gcaaaggtaccggtaacctctttagaaacctgcaaacaggtgaaagatgagaagcccaga
gcagggccagaggactatgttttcactgacaacatgatctgtgctggtgagaatggtgtt
gacagctgtaatggggacagtgggggcgcttttgctttccaggtccccaatgtcaaggtc
cccaaattctatgtagctggcttggtgtcttgggggaaaaagtgtgggacctatggggtc
tacacaaaggtaaagaattacgtggactggatcctgaaaactattcaggagaatagtggg
cccaggaaggactaa

DBGET integrated database retrieval system