KEGG   Mus pahari (shrew mouse): 110314999
Entry
110314999         CDS       T05929                                 
Name
(RefSeq) complement C1r-A subcomponent-like
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110314999
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110314999
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110314999
  09171 Infectious disease: bacterial
   05133 Pertussis
    110314999
   05150 Staphylococcus aureus infection
    110314999
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110314999
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110314999
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110314999
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     110314999
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110314999
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110314999
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA hEGF
Other DBs
NCBI-GeneID: 110314999
NCBI-ProteinID: XP_021044830
LinkDB
Position
Unknown
AA seq 750 aa
STKEASSSEEDPATDTENGEEDSEAENETAAAVPEPPPRDITEWLFTLLVTLFYGVEGSM
YLPQKLYGEVTSPLYPKPYPSDWETTTVITVPMGYRVKLVFWHFDVEPSEGCFYDYVKIS
ADKQTLGRLCGQLDSPLGNPPGSKEFVSQGNKMLLTFHTDFSNEENGTITFYKGFLAYYQ
AVDLDECASQPKSVEEGSQPRCQHLCHNYVGGYFCSCHRGYELQKDGQSCQAECSRELYT
EPSGYVSSLEYPQPYPPDLRCNYSIRVKRGLTVHLKFLDPFEIDDHQQVHCPYDQLQIHA
NGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLHYTTEIIKCPQPKALDEFT
VIQGPQPQYQFQDYFIVTCKQGYQLMEGDQELLSFSAVCQHDGTWHRAMPRCKIKNCGQP
RSLSNGDLRYITTKGVNTYEARIQYYCNEPYYKMLTRAGSSESVRGIYTCTAQGIWKNEE
EGEKMPRCLPVCGKPVNPVTQKQRIIKGQKASPGNFPWQAFTNIHGRGGGALLGDRWILT
AAHTIYPKEHNKENDNDANPRTPVYLGHTNVQQIKDLGHHPVRRVIIHPDYRQDEPNNFE
GDIALLELENSVTLGPELLPICLPDNETFYDKGVMGYVSGFGITGNKIAFDLKFVRLPVA
DREACQRWLQAKKNNDVFSENMFCSGDPNIEQDTCQGDSGSVFAVRDQNRDIWVATGIVS
WGLVCGEGYGFYTKLLNYVDWIKKEMGDEN
NT seq 2253 nt   +upstreamnt  +downstreamnt
agcaccaaagaggcttcctcctcagaggaggaccccgccactgatacagaaaatggcgaa
gaggatagcgaagctgaaaatgagactgcggccgcagttcctgagcccccaccacgagac
ataactgagtggctcttcaccctcctggtgaccctgttctatggggtggagggctccatg
tacctccctcagaagctctatggagaggtgacctctcctctgtatcccaagccttacccc
agtgactgggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtc
ttctggcattttgatgtggagccttctgaaggctgtttctatgactatgttaagatttct
gctgataagcagactctggggaggctctgtgggcaactggattctcccctgggcaacccc
ccaggaagcaaggaattcgtgtcccaaggaaacaagatgctgctgaccttccacacagac
ttctccaatgaggagaatgggaccatcacattctacaagggcttcctggcctactaccag
gctgtagaccttgatgaatgtgcatcccagcccaaatcagtggaagagggttcgcagccc
cgatgccaacacctgtgtcacaactatgttggaggctacttctgttcctgccatcgtggc
tacgagcttcagaaagatgggcaatcctgccaggctgagtgcagcagggagctctacaca
gagccctcgggctatgtctccagtctcgaataccctcagccctatccaccggatctacgc
tgcaactacagcatccgggtgaagaggggcctcactgtgcacctcaagttcctggatcct
tttgaaatcgatgaccaccagcaagtgcactgtccctatgaccagcttcagatccatgct
aatgggaagaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagc
agcaatgcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaag
ctgcactacactactgaaatcatcaagtgcccccagcccaaggctctggatgagttcacc
gtcatccaaggtccacaacctcagtaccagttccaggattacttcattgtcacctgcaag
caaggctaccagctcatggagggagatcaggagctactctccttctcagctgtttgccag
catgatggcacgtggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccc
cgaagcctgtctaatggggacttacgctacatcaccaccaaaggcgtgaacacctatgaa
gccaggatccagtattactgcaatgaaccatattacaagatgctgaccagagctggcagc
agtgagtctgtgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagag
gaaggagagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtaaca
cagaagcagcgcatcatcaaggggcagaaagccagtcccggcaacttcccctggcaggcc
ttcaccaatatccatgggcgagggggtggggccctgcttggagaccgctggatcctcaca
gcagcccacaccatctatcccaaggaacacaacaaagaaaacgacaacgatgccaaccca
agaacgcctgtttacctgggccacacaaacgtgcaacagatcaaagacctgggacatcac
cctgtccgtagggtcatcatacacccagactaccgccaagatgaacctaacaattttgaa
ggagatattgctctactggagctggaaaacagtgtcacactgggcccggaactcctcccc
atctgtctcccagacaatgagaccttctatgacaaaggtgtcatgggttatgtcagtgga
ttcgggataacaggaaataagatagctttcgatctcaagtttgtcagactgcctgtagct
gatcgagaggcatgccagagatggctccaggcaaaaaagaataatgatgtattttctgaa
aatatgttttgttctggggacccaaatatagagcaagacacctgccagggggatagtggg
agtgtttttgcagtcagggatcaaaatcgtgatatctgggtggctacgggcatcgtatcc
tggggccttgtgtgtggtgagggatacggcttctataccaagttactgaattatgttgac
tggatcaagaaagagatgggagatgaaaactga

KEGG   Mus pahari (shrew mouse): 110316472
Entry
110316472         CDS       T05929                                 
Symbol
C1r
Name
(RefSeq) complement C1r subcomponent
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110316472 (C1r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110316472 (C1r)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110316472 (C1r)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110316472 (C1r)
   05150 Staphylococcus aureus infection
    110316472 (C1r)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110316472 (C1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110316472 (C1r)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110316472 (C1r)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     110316472 (C1r)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110316472 (C1r)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110316472 (C1r)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA hEGF EGF
Other DBs
NCBI-GeneID: 110316472
NCBI-ProteinID: XP_021046472
Ensembl: MGP_PahariEiJ_G0022602
LinkDB
Position
2:139641305..139651995
AA seq 708 aa
MWLFALLMTLFSGVEGSVYLPQKLYGEVTSPLYPKPYPSDWETTTVITVPMGYRVKLVFW
HFDVEPSEGCFYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGSQPRCQHLCHNYVGGYFCSCRPGYE
LQKDGQSCQAECSRELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFE
IDDHQQVHCPYDQLQIYAKGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLH
YTTEIIKCPQPKALDEFTIIQDMQPQYQFRDYFIVTCKQGYQLMEGNQAIVSFSAVCQHD
GTWHRAMPRCKIKNCGQPRSLSNGDLRYITTKGVNTYEARIQYYCNEPYYKMLTRAGSSE
SVRGIYTCTAQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKQRIIKGQKASPGNFPWQAFT
NIHGRGGGALLGDRWILTAAHTIYPKEHNKENDNDANPRTPVYLGHTNVQQIKDLGHHPV
RRVIIHPDYRQDEPNNFEGDIALLELENSVTLGPELLPICLPDNETFYDKGLMGYVSGFG
ITEDKIANDLRFVRLPVADREACQRWLRTKKENNVFSQNMFCSGDPSIQQDACQGDSGSV
FAVRDRNRDIWVATGIVSWGIGCGEGYGFYTKLLNYVDWIKKEMGEDS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgtggctctttgccctcctcatgaccctgttctctggggtggagggctccgtctacctc
cctcagaagctctatggagaggtgacctctcctctgtatcccaagccttatcccagtgac
tgggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtcttctgg
cattttgacgtggagccttcagaaggctgcttctatgactatgttaagatttctgccgat
aagcagactctggggaggttctgtgggcagctggattctcccctgggcaaccccccagga
agcaaggaattcatgtcccagggaaacaagatgctactgaccttccacacagacttctcc
aatgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggctgtg
gatcttgatgaatgtgcatcccagcccaactcagtggaagagggttcgcagccccgatgc
caacacctgtgtcacaactatgttggaggctacttctgttcctgccgtcctggctatgag
cttcagaaagatgggcaatcctgccaggctgagtgcagcagggagctctacacggagccc
tcgggctatgtctccagtctcgaataccctcagccctatccaccggatctacgctgcaac
tacagcatccgggtggagaggggcctcactgtgcacctcaagttcctggatccttttgaa
attgatgaccaccagcaagtgcactgcccttatgaccagctccagatctatgctaagggg
aaaaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagcagcaat
gcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaagctgcac
tacaccactgaaatcatcaagtgcccccagcccaaggctctggatgagttcaccatcatc
caagatatgcaacctcagtaccagttccgggattacttcattgtcacctgcaagcaaggc
taccagctcatggagggaaatcaggcgatagtctccttctcagctgtttgccagcatgat
ggcacgtggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccccgaagc
ctgtctaatggggacttacgctacatcaccaccaaaggcgtgaacacctatgaagccagg
atccagtattactgcaatgaaccatattacaagatgctgaccagagctggcagcagtgag
tctgtgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagaggaagga
gagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtaacacagaag
cagcgcatcatcaaggggcagaaagccagtcccggcaacttcccctggcaggccttcacc
aatatccatgggcgagggggtggggccctgcttggagaccgctggatcctcacagcagcc
cacaccatctatcccaaggaacacaacaaagaaaacgacaacgatgccaacccaagaacg
cctgtttacctgggccacacaaacgtgcaacagatcaaagacctgggacatcaccctgtc
cgtagggtcatcatacacccagactaccgccaagatgaacctaacaattttgaaggagat
attgctctactggagctggaaaacagtgtcacactgggccccgaactcctccccatctgt
ctcccagacaatgagaccttctatgacaaaggcctcatgggatatgtcagcggatttggg
ataacagaagataagatagctaacgatctcaggtttgtccgactgcctgtagctgacaga
gaggcatgccagagatggctccggacaaaaaaggaaaataatgtattttctcaaaacatg
ttctgttctggggatccaagtatacagcaagatgcctgccagggagacagtgggagtgtt
tttgcagtcagggaccgaaatcgtgatatctgggtggctacgggcatcgtatcctggggc
attgggtgtggtgagggatatggcttctacaccaagttactgaattatgttgactggatc
aagaaagagatgggagaagacagctga

DBGET integrated database retrieval system