KEGG   Mus pahari (shrew mouse): 110315308
Entry
110315308         CDS       T05929                                 

Gene name
Arntl
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1 isoform X1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110315308 (Arntl)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110315308 (Arntl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110315308 (Arntl)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110315308 (Arntl)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 110315308
NCBI-ProteinID: XP_021045307
Ensembl: MGP_PahariEiJ_G0013551
LinkDB
Position
1
AA seq 633 aa
MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLVDFAFEESMDTD
KDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGG
PKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDAS
SPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSP
SNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcggaccagagaatggacatttcctcaacaatcagtgacttcatgtctccgggcccc
accgacctgctctccggttccctgggcaccagtggtgtggactgcaatcgcaagaggaaa
ggcagtgccactgactaccaacttgttgactttgcttttgaagaaagtatggacacagac
aaagatgaccctcatggaaggttagaatatgcagaacaccaaggaaggatcaagaatgca
agggaggcccacagtcagattgaaaagaggcgtcgggacaaaatgaacagtttcattgac
gaattggcatctttggtaccgacatgcaatgcgatgtccaggaagttagataaactcact
gtgctgaggatggctgttcaacacatgaaaacgttgagaggtgccaccaacccatacaca
gaagcaaactacaagccaacatttctatccgatgacgaactgaaacacctaattctcagg
gcagcagatggatttttgtttgtcgtaggatgtgaccgagggaagatcctcttcgtctct
gagtctgtcttcaagatcctcaattatagccagaatgaccttattggccagagcttgttt
gactacctgcatccaaaagatattgccaaagttaaggaacagctatcttcctcggacact
gcgccccgggagcgactcattgatgccaagactggacttccggttaaaacggatataacc
cctgggccctcccggctatgctctggagctcgccgctctttcttctgtaggatgaagtgc
aacaggccttcagtaaaggtggaagataaggacttcgcctccacctgttcaaagaaaaaa
gcagatcgaaaaagcttctgcacaatccacagcacaggctatttgaaaagctggccaccc
acaaagatggggctagacgaagacaatgagccagacaatgagggctgcaacctcagctgc
ctcgttgctatcgggcgcctgcactcgcacatggttccacaaccagcgaatggggagata
cgggtgaaatctatggagtacgtttctcgacacgcaatagatgggaaatttgtttttgta
gatcagagggcgacagctattttggcatatctaccacaggaacttctaggtacatcatgt
tatgagtattttcatcaagatgacataggacaccttgcagaatgtcacaggcaagtttta
cagacaagagaaaagatcacaactaattgctataagtttaagatcaaggatggttctttt
atcacactacgaagtcgatggttcagtttcatgaacccgtggaccaaggaagtagaatac
attgtctcaaccaacactgttgttttagccaatgtcctggaaggcggggacccaaccttc
ccgcagctaacagcacccccccacagcatggacagcatgctgccctctggagaaggtggc
ccaaagaggactcatcccactgttccaggcattccagggggaaccagagctggagcagga
aagataggtcgaatgattgcagaggaaatcatggaaatccacaggataagagggtcatca
ccttccagctgtggctccagcccactgaacatcacaagtacgcctccccctgatgcctct
tctccaggaggcaagaagattctaaatggagggactccagacattccttccactggacta
ttaccagggcaggctcaggagaccccaggttatccctattctgatagttcttctattctt
ggtgagaacccccacataggcatcgatatgatagacaacgatcaaggatcaagtagtccc
agtaacgatgaggcagcaatggctgtcatcatgagcctcttggaagcagatgcagggctg
ggtggtcccgttgactttagtgacttgccatggccactgtag

DBGET integrated database retrieval system