KEGG   Mus pahari (shrew mouse): 110316081
Entry
110316081         CDS       T05929                                 
Symbol
A2m
Name
(RefSeq) alpha-2-macroglobulin
  KO
K03910  alpha-2-macroglobulin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110316081 (A2m)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110316081 (A2m)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110316081 (A2m)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110316081 (A2m)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   110316081 (A2m)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110316081 (A2m)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110316081 (A2m)
SSDB
Motif
Pfam: TED_complement A2M MG3 A2M_BRD A2M_recep MG4 MG2 SVA BIg21
Other DBs
NCBI-GeneID: 110316081
NCBI-ProteinID: XP_021045820
Ensembl: MGP_PahariEiJ_G0022573
LinkDB
Position
2:137189033..137233524
AA seq 1474 aa
MGKHRLPSLALLPLQPLLLLLLPLLLPTDASAPQKPIYMVMVPSLLHAGTPEKGCLLFSH
LNETVMVRVSMESVRGNQSLFTDLVVDKDLFYCASFIVPQSSSNEVMFLTVQVKGPTHEF
RRRSAVLVKTKESLVFAQTDKPIYKQGQTVRFRVVSLDENFHPLNELIPLLYIQDSKKNR
IAQWQNFRLEGGLKQLSFPLSSEPTQGSYKVVIRTESGRTVEHPFSVEEFVLPKFEVKVT
VPETITILEEEMNVSVCGLYTYGKPVPGRVTVNICRKYSNPSSCFGEESLAFCEKLSQQL
DSRGCFSQLVKTKSFQLKRQEYEMQLDVNAKIQEEGTGVEETGKGLTKITRTITKLSFVN
VDTHFRQGIPYIGQVLLVDGRGTPIPYEMVFIGVDEANQNINTTTDKNGLARFSINTDDI
LGTSLTVRAKYKDSNVCYGFRWLTEENVEAWHTANAVFSPSRSFVYLESLPDKLRCEQTL
AVQAHYILNDETVLERKELVFYYLMMAKGGIVLAGTHSLPVKQGHKKGHFSILISVETGL
APVARLVLYTILPNGEVVGDTVKYEIENCLANKVDLVFHPNSGLPATRALLSVTASPQSL
CGLRAVDQSVLLLKPEAELSASLVYDLLPVRDLTGFPEGVNQQEEDTNGCIKQNDTYING
ILYSPVQNTNEEDMYGFLKDMGLKVFTNLNIRKPKVCERLGVNRIPAAYHLVSQGHMDAF
LESSESPTETARSYFPETWIWDLVTVDSTGVAEMEVTVPDTITEWKAGAFCLSDDTGLGL
SPVIDFQAFQPFFVDLTMPYSVIRGEAFTLKATVMNYLQTCIWVGVQLEASPDFLAAPEE
KEQKSHCICMNERHTTSWAVIPKSLGNVNFTVSAEALDSKELCRNEVTVVPERGKKDTII
KSLLVEPEGLENEVTFNSLLCPTGAEVSEQISLKLPSDVVEESARASVTVLGDILGSAMQ
NTQDLLNMPYGCGEQNMVLFAPNIYVLDYLNETEQLTQEIKTKAITYLNTGYQRQLNYKH
RDGSYSTFGDKPGRSHANTWLTAFVLKSFAQARRYIFIDESHITQALTWLSQQQKDNGCF
RSSGSLLNNAMKGGVEDEVTLSAYITIALLEMSLPVTHPVVRNALFCLDTAWKSERRGVS
GSHVYTKALLSYAFALAGNQDTKKEILKSLDEEAVKEDSSLHWTRAQKPRVPADLWYQPQ
APSAEVEMTAYVLLAYLTSKPPPTREDLTAAMLIAKWLIKQQSSHGGFSSTQDTVVALHA
LSKYGAATFTRAKKAAHVTLQSSGAFSTKFQVNNDNQLLLQRVTLPTVPGDYTAKVAGEG
CVYLQTSLKYSVLPREKDFPFALVVQTLPGTCEDLKAHTSFQISLNISYIGSRSDSNMAI
ADVKMVSGFIPLKPTVKMLERSVHVSRTEVSNNHVLIYLDKVSNQTLTLSFMVQQDIPVR
DLKPAIVKVYDYYEKDEFAVAKYSAPCGADYGNA
NT seq 4425 nt   +upstreamnt  +downstreamnt
atggggaagcacaggctcccaagcctggccctgctgcctctgcagccgctgctgctgctg
ctgctgccgctgctgctgcccacagatgcctcagcaccacagaaaccaatctacatggtg
atggttccttccctgctccacgctggcacccctgagaagggctgcctcctgttcagccac
ctaaatgagacagtgatggtgagagtttctatggagtctgtccgtgggaaccaaagcctc
ttcactgaccttgtggttgacaaggacttattctactgtgcctcctttatcgtcccacag
tcttcatccaatgaggtgatgtttctcactgtccaagtcaaaggaccaactcatgagttc
aggaggaggagcgcggtgctggtcaagactaaagagagcctggtctttgctcagactgac
aagcccatctacaaacaaggacagacagtgcgatttcgtgttgtctcattggacgaaaat
ttccacccccttaatgaattgattcctctactgtacattcaggattccaaaaaaaatcgc
attgcacagtggcagaatttccgcttagagggtggcctcaaacagctgtccttccccctc
tcctcagagcccactcagggctcctacaaggttgtgatacgtacagaatcaggcaggacc
gtcgagcaccccttctctgtggaggaattcgtgcttcccaagtttgaagtgaaggttaca
gtaccggagacaatcaccatcctggaggaagagatgaatgtgtcggtgtgcggcctatac
acctatgggaagcctgttccgggacgcgtgactgtgaacatttgcagaaagtacagtaat
ccctccagctgcttcggtgaagaatccctggctttctgtgagaaactcagtcaacagcta
gacagccgcggctgcttctcacagctagtgaaaaccaagtctttccagctaaagaggcaa
gagtacgagatgcagcttgatgtgaacgccaagatacaagaagaagggacaggtgtggaa
gaaaccggaaaagggcttactaagattacaagaactataacgaaactatcatttgtgaat
gtggatacacatttcagacaaggaattccttacattgggcaggtgctcctggtagatggg
agaggcacccctattccatatgaaatggtcttcattggagttgatgaagcaaaccagaac
ataaacactaccactgataagaatggcctggcacggttctccatcaacactgatgacatc
ttgggcacgtccctaactgtcagggccaaatacaaggatagcaatgtctgctatggattt
cgatggttgacagaagagaacgtagaggcttggcacactgccaacgccgtcttctcaccg
agcagaagcttcgtgtacctggaatccctgcccgataaactgcgctgtgagcaaaccctg
gcggtccaggctcattatattctaaatgatgagactgtgctggagcggaaggagctggtc
ttctactacctgatgatggcaaagggaggcattgttctggcggggactcacagtctgcct
gtgaagcagggacacaagaaaggtcatttctccatcctcatctccgtggagacaggcctg
gctcctgtagctcgactggtcctttataccattctgcccaatggagaagtggttggagat
actgtcaaatacgagattgaaaactgcctggccaacaaggtggacttggtcttccaccca
aatagcggtcttccagccacacgtgccctcctcagtgtcacagcttctcctcagtctctc
tgtggcctgcgagctgtggaccagagcgtgctgctcctgaaacccgaagctgagctctct
gcatccctggtttatgatctgctgccagtgagagacctcactggcttccccgagggcgtg
aatcaacaggaagaagacactaatggctgcattaagcaaaatgacacttacattaatgga
atcctgtactccccagtacagaatacaaatgaagaggacatgtatggcttcctaaaggat
atgggcttaaaggtattcaccaacttgaacatccgtaaacccaaagtctgtgaacgcctt
ggagtcaatagaataccagctgcataccaccttgtaagccaaggccacatggatgctttt
ctagagtcttcagagtctcccacagagactgcacgaagctacttccctgagacatggatc
tgggacttggtgactgtggactcaacaggagtggctgaaatggaagtgacagtccctgac
accatcactgaatggaaggccggagccttctgcctgtccgatgacaccgggttgggcctg
tctcccgtgatcgatttccaagccttccagcctttcttcgtggatctcacaatgccctac
tctgtgatccgtggagaagccttcacgctcaaagccactgtgatgaactacctccaaaca
tgcatctgggttggtgtacagctggaggcctctcctgatttcctagctgccccagaggag
aaagaacaaaagtctcactgcatctgtatgaatgagcggcacaccacgtcctgggctgtg
atccccaagtcattaggaaatgtgaatttcacagtgagtgcagaggcactggactctaag
gagctgtgtaggaatgaggtgacagtggttcctgaacgtggaaagaaagacacgatcatc
aagtccctgctggttgaacctgaaggtctagagaatgaagtgacgttcaacagtttgctt
tgtccaacgggtgctgaagtatcggaacagatatcgctgaagctgccatcagatgtggta
gaggaatctgcccgagcttctgtcacagttttgggagatatattgggttctgccatgcag
aacacacaggatctcctcaacatgccctatggctgtggagaacagaacatggttctgttt
gctcccaatatctatgtcctggattatctgaatgaaacagagcagctgacacaggagatc
aagaccaaggccattacctatcttaacacaggttaccaaagacaattaaactacaagcac
cgggatggctcctacagcacttttggggataaacctggcaggagtcatgccaatacctgg
ctcacagcctttgtactgaagagttttgctcaggctcgaagatatatcttcatcgatgaa
tcacatatcacccaagccctcacctggctctcccagcagcagaaggacaatggctgcttc
aggagctctgggtcactgctcaacaatgccatgaagggaggagtagaagatgaagtcact
ttgtctgcctacatcaccatcgctctcctggaaatgtctcttcctgtcactcatcctgtt
gtccgcaatgccctcttttgcctggacacagcctggaagtcagagaggagaggagtcagt
ggcagccatgtctacactaaggcactgttatcctatgcatttgcccttgctggtaaccag
gacacgaagaaggagatactgaaatcacttgatgaggaggcagtaaaagaagacagttct
cttcactggaccagagctcagaaacccagagtgccggcggatctgtggtaccaaccccag
gctccctcggctgaggtagagatgactgcttatgtgctcctggcttatcttaccagcaag
ccacctccaacccgagaggacctgactgctgcgatgctcattgcgaagtggctcataaag
cagcagagttcccatggtggcttctcctccacccaggacacggtagtggctctccacgct
ttgtccaaatacggagcagctactttcacaagagcgaagaaagctgcgcatgtgaccctc
cagtcttcaggcgcattttctacaaaattccaagtgaacaacgacaaccaattattacta
cagagagtcacattgccaactgtgcctggggattacactgcgaaggtagctggagaaggg
tgtgtctacctccagacatccttgaaatacagtgttctcccgagggagaaggacttccca
tttgctttggtggtgcagactctgcctgggacttgtgaggatctcaaagctcacaccagc
ttccagatctcactcaatatcagttacattggaagccgttctgactccaacatggcaatt
gccgatgtgaagatggtgtctggattcatccccttgaaaccaacagtgaaaatgcttgaa
agatctgtgcatgtgagccgaacagaagtcagcaataaccatgtcttgatttacttggat
aaggtgtcaaatcagacgctgaccttgtccttcatggtgcagcaagatattccagtaaga
gacctgaagccagccatagtgaaagtctatgattactacgagaaagatgagtttgcagtt
gcaaaatacagtgctccctgcggtgcagattatggaaatgcctga

DBGET integrated database retrieval system