KEGG   Mus pahari (shrew mouse): 110316104
Entry
110316104         CDS       T05929                                 

Symbol
Met
Name
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah05100  Bacterial invasion of epithelial cells
mpah05144  Malaria
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05211  Renal cell carcinoma
mpah05218  Melanoma
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316104 (Met)
   04014 Ras signaling pathway
    110316104 (Met)
   04015 Rap1 signaling pathway
    110316104 (Met)
   04020 Calcium signaling pathway
    110316104 (Met)
   04151 PI3K-Akt signaling pathway
    110316104 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110316104 (Met)
   04520 Adherens junction
    110316104 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110316104 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316104 (Met)
   05202 Transcriptional misregulation in cancer
    110316104 (Met)
   05206 MicroRNAs in cancer
    110316104 (Met)
   05205 Proteoglycans in cancer
    110316104 (Met)
   05208 Chemical carcinogenesis - reactive oxygen species
    110316104 (Met)
   05230 Central carbon metabolism in cancer
    110316104 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316104 (Met)
   05226 Gastric cancer
    110316104 (Met)
   05218 Melanoma
    110316104 (Met)
   05211 Renal cell carcinoma
    110316104 (Met)
   05223 Non-small cell lung cancer
    110316104 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110316104 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    110316104 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316104 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110316104 (Met)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110316104 (Met)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  MET family
   110316104 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TIG Sema PSI Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 110316104
NCBI-ProteinID: XP_021045848
Ensembl: MGP_PahariEiJ_G0021874
LinkDB
Position
2
AA seq 1379 aa
MKAPTVLAPGILVLLLTLVKRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGS
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCFPCQDCSNKANSSGGVWKDNINVAL
LVDTYYDDQLISCGSVDRGTCRRHVLPPDNPADIHSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
RDSYPIKYIHAFESNHFIYFLTVQKETLGAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRRRSTREEVFNILQAAYVSKPGASLAKQIGASPSDDILYGVFAQSKPDSAEPMNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSEEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNFLL
DSHPVSPEVIVEHPSDQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRSDECPSSTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPTMSEHFNVSVIISNSRETTQYSAFSYVNPVVTS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTISAEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHE
VGMNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISMGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLSSGLFLWLRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTAEMVSHESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgaccttggtgaag
aggagccatggggagtgcaaggaggccttagtgaagtctgagatgaacgtgaacatgaag
tatcagcttcccaacttcacagcagaaacccccatccagaatgtggttctacacggcagt
catatttatcttggagccacaaactacatttatgttttaaatgacaaagacctgcagaag
gtatccgagttcaagaccgggcccgtgttggaacacccagattgttttccttgtcaggac
tgcagcaacaaagccaattcatcaggaggggtttggaaagacaacatcaacgtggctctg
ctcgttgacacatactatgatgatcaactcatcagctgtggcagtgtcgacagagggacc
tgccggcggcatgtccttcctcctgacaaccctgctgacatacactccgaggttcactgc
atgttctccccagaagaagagtcaggtcagtgtcctgactgtgtagtgagtgcccttgga
gccaaagtcctcctgtctgaaaaggaccggttcatcaatttctttgtggggaatacgatc
aattcttcctatcctcccggttattcgctgcattcaatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgacagaccagtcctatattgatgtcttaccagaattc
cgagattcctaccccataaagtacatacatgcctttgaaagcaaccattttatttacttc
ctgactgtccaaaaggaaaccctaggtgctcagacttttcatacaagaataatcaggttc
tgttccgtagactcggggttgcactcctacatggaaatgcccctggaatgcattctgaca
gaaaaaagaagaaggagatccacacgggaagaagtgtttaatatcctccaagctgcatac
gtcagcaaaccgggggccagtcttgcaaagcagataggcgctagcccatctgatgacatt
ctctatggggtgtttgcacaaagcaagccagattctgctgagcccatgaatcgatcagca
gtctgtgcgttccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aatgtgagatgtctccagcatttttatggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttcgggctgtgaagcgcgcagcgaggagtatcggacagaattcacc
acggctttgcagcgcgttgacttattcatgggccggctcaaccaggtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtagtgctctctcggacggcacacttcacccctcatgtgaacttcctcctg
gattcccatcctgtgtctccagaagttattgttgagcatccatcagatcaaaatggctat
acattggttgtcacaggaaagaagatcaccaagattccactgaatggcctgggctgtgga
catttccagtcctgcagtcagtgtctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttctgatgaatgccccagcagtacatggactcaagagatctgt
ctgccagcagtttataaggtgttccccaccagtgcgccccttgaaggaggaacagtgctg
accatctgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccacgatgagtgagcacttcaatgtgtctgtaattatctcc
aacagtcgagagacaacacaatacagtgcattttcctacgtaaaccctgtagtaacaagc
atctctccgaggtacggccctcaggctggaggcaccttactcacgttaactgggaaatac
ctcaacagtggcaattctagacacatttcaattggcgggaaaacgtgtactttaaaaagt
gtatcagatagtattctcgaatgctacaccccagcccaaactatctctgctgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctgaactcggtcagcctcccaaagctggtaatagatgtgcatgaa
gtgggtatgaactacacagtggcatgtcagcatcgctcaaactcagagatcatctgctgc
accactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggatcctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccattggcattccggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgtccttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgctgtctcaata
tcagtagtagttttgttatcatccgggctcttcctgtggctgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactgcagagatggtttcacatgagtctgtggac
tacagagccacttttccagaagaccagtttcccaactcctctcagaatggagcgtgcaga
caagtgcaatatccgctaacagacctgtcccccatcctgacgagtggagactctgatata
tccagcccgttgctacaaaatactgttcacattgacctcagtgctctaaatccagagctg
gtccaagcagtgcagcatgtagtgattggacccagtagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgttggacaatgacgga
aagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaattatcatgaaagacttcagccatcccaatgttctctcactc
ctgggaatctgcctacggagtgaagggtctcctctggtggtcctgccctacatgaagcat
ggagatcttcgaaatttcattcgaaatgagactcacaatccaactgtgaaagatcttata
ggatttggtcttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agggacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaaggttgctgat
tttggtcttgccagagacatgtacgataaagagtactatagtgttcacaacaaaacaggt
gcaaagctaccagtgaagtggatggctttagagagtctgcagacgcagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgcttctctgggagctcatgacgcgaggagcccct
ccttaccccgacgtgaacacatttgacatcactatctacctgttacaaggcagaagactc
ttgcagccagaatactgccccgatgccttgtatgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccatccttttctgaactggtctccaggatatcctcaatcttctcc
acgttcattggggagcactatgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgacggcgaggggaacacatga

KEGG   Mus pahari (shrew mouse): 110324292
Entry
110324292         CDS       T05929                                 

Symbol
Igf1r
Name
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04114  Oocyte meiosis
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04730  Long-term depression
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110324292 (Igf1r)
   04014 Ras signaling pathway
    110324292 (Igf1r)
   04015 Rap1 signaling pathway
    110324292 (Igf1r)
   04066 HIF-1 signaling pathway
    110324292 (Igf1r)
   04068 FoxO signaling pathway
    110324292 (Igf1r)
   04151 PI3K-Akt signaling pathway
    110324292 (Igf1r)
   04152 AMPK signaling pathway
    110324292 (Igf1r)
   04150 mTOR signaling pathway
    110324292 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110324292 (Igf1r)
   04140 Autophagy - animal
    110324292 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110324292 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324292 (Igf1r)
   04520 Adherens junction
    110324292 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    110324292 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110324292 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    110324292 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    110324292 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    110324292 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    110324292 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324292 (Igf1r)
   05202 Transcriptional misregulation in cancer
    110324292 (Igf1r)
   05205 Proteoglycans in cancer
    110324292 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110324292 (Igf1r)
   05214 Glioma
    110324292 (Igf1r)
   05218 Melanoma
    110324292 (Igf1r)
   05215 Prostate cancer
    110324292 (Igf1r)
   05224 Breast cancer
    110324292 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110324292 (Igf1r)
   01522 Endocrine resistance
    110324292 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110324292 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110324292 (Igf1r)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110324292 (Igf1r)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   110324292 (Igf1r)
CD molecules [BR:mpah04090]
 Proteins
  110324292 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 110324292
NCBI-ProteinID: XP_021057394
Ensembl: MGP_PahariEiJ_G0013077
LinkDB
Position
1
AA seq 1374 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKADKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEY
RKVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSKNTTVADTYNVTDPEEFETEYPFF
ESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPV
TWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRECVSRQEYRKYGGAKLNRLNP
GNYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVF
HRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVA
KGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVI
MELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLA
ARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWS
FGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRP
SFLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELELEPENMESVPLDPSASSAS
LPLPERHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4125 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctgttccgagtggccggcctcgagagcctgggagacctcttc
ccgaacctcacggtcatccgtggctggaaactcttctacaactacgcactggtcatcttc
gagatgaccaatctcaaggatatcgggctttataatctgaggaacattactcggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcagtgtccaataactacattgtggggaacaagcccccaaaggaatgtggggac
ctgtgtccagggactttggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggacgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgc
gtgcccgcctgcccgcctggcacctacaggtttgagggctggcgctgtgtggaccgcgat
ttctgcgccaacatccccaacgctgaaagcagtgactcggatggcttcgttatccacgac
gacgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgtgaaggcccctgccccaaagtctgcggcgatgaagaaaagaaaacgaaa
accatcgattcggttacctctgctcaaatgctccaaggctgcaccatcttgaagggcaat
ctgcttattaacatccggcgaggcaataacattgcctcggagttggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaacctccgtctcatcttaggagaggagcagctggaagggaactattcc
ttctacgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtcggggaaaatgtactttgctttcaaccccaagctgtgtgtctctgaaatt
taccgcatggaagaagtgactggaaccaagggacgccagagcaaaggggacataaacacc
aggaacaatggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacg
acctggaagaaccgaatcatcataacgtggcaccggtaccggccaccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccctttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtggacctgcctccgaac
aaggagggggagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccacatccgtggggccaaaagt
gaaatcttgtacattcgtaccaatgcttcagtcccttccatccccctggatgtcctctcg
gcatcaaactcttcctctcagctgattgtgaagtggaaccccccaactctgcccaatggg
aacctgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctccaaagcagacaaaatacccatcagaaagtatgccgatggtaccatc
gacgtggaggaggtgacagaaaatcccaagacagaagtatgtggtggtgataaagggcca
tgctgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggcagagtac
cgtaaagtctttgagaatttccttcacaattccatctttgtgcccagacccgaaaggagg
cggagagatgtcatgcaagtggccaacaccaccatgtccagccggagcaagaacaccaca
gtagctgacacctacaatgtcacagacccggaggagttcgagacagagtaccctttcttt
gagagcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactcta
taccgcatcgatattcacagctgcaaccacgaggctgagaagctgggctgcagcgcctcc
aacttcgtctttgcgagaaccatgccagcagaaggagcagatgatattcctggtccagtg
acctgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaacccc
aacggattgatcctaatgtatgaaataaaatacggatcgcaaatcgaggatcagcgggaa
tgtgtgtccagacaggagtacaggaagtacggaggggccaaacttaaccgtctaaaccca
gggaactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagat
cctgtgttcttctatgtcccagccaaaacaacgtatgagaacttcatgcatctgatcatt
gctctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttc
catagaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccct
gagtatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaag
atcaccatgaaccgagagctcggacaagggtcctttgggatggtctatgaaggagtggcc
aagggcgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtgaacgaggct
gcaagtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaagagttcaat
tgtcaccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatc
atggaactaatgacacgtggcgatctcaaaagttatctccggtctctgaggccagaagtg
gagcagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctgga
gagattgcagatggcatggcttacctcaatgccaacaagttcgtccacagagaccttgct
gctcggaactgcatggtagccgaagatttcactgtcaaaattggagactttggtatgaca
cgggatatctacgagacagactactaccggaaaggcgggaaggggctgctgcctgtgcgc
tggatgtctcccgagtcgctcaaggatggcgtcttcactactcattctgatgtctggtcc
tttggggtcgtcctctgggagatcgccacgctggctgagcagccgtaccagggcttgtcc
aacgagcaagttcttcgtttcgtcatggagggcggccttctggacaagccggacaactgc
cccgatatgctgtttgaactcatgcgcatgtgctggcagtataaccccaagatgcggccc
tccttcctggagatcatcggcagcatcaaggatgagatggagcctagcttccaggaggtc
tccttctactacagcgaggagaacaagcctcccgagccggaggagctggagatggagctg
gagctggagcccgagaatatggagagcgttccgctggacccttccgcctcctcagcctcc
ctgcctctgcctgaaagacactcaggacacaaggctgagaatggcccgggccctggcgtg
ctggttctccgtgccagttttgatgagagacagccttacgctcacatgaatgggggacgc
gccaacgagagggccttgcctctgccccagtcctcgacctgctga

KEGG   Mus pahari (shrew mouse): 110330480
Entry
110330480         CDS       T05929                                 

Symbol
Egfr
Name
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330480 (Egfr)
   04012 ErbB signaling pathway
    110330480 (Egfr)
   04014 Ras signaling pathway
    110330480 (Egfr)
   04015 Rap1 signaling pathway
    110330480 (Egfr)
   04630 JAK-STAT signaling pathway
    110330480 (Egfr)
   04066 HIF-1 signaling pathway
    110330480 (Egfr)
   04068 FoxO signaling pathway
    110330480 (Egfr)
   04020 Calcium signaling pathway
    110330480 (Egfr)
   04072 Phospholipase D signaling pathway
    110330480 (Egfr)
   04151 PI3K-Akt signaling pathway
    110330480 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110330480 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110330480 (Egfr)
   04520 Adherens junction
    110330480 (Egfr)
   04540 Gap junction
    110330480 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110330480 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110330480 (Egfr)
   04915 Estrogen signaling pathway
    110330480 (Egfr)
   04921 Oxytocin signaling pathway
    110330480 (Egfr)
   04926 Relaxin signaling pathway
    110330480 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    110330480 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330480 (Egfr)
   05206 MicroRNAs in cancer
    110330480 (Egfr)
   05205 Proteoglycans in cancer
    110330480 (Egfr)
   05207 Chemical carcinogenesis - receptor activation
    110330480 (Egfr)
   05208 Chemical carcinogenesis - reactive oxygen species
    110330480 (Egfr)
   05230 Central carbon metabolism in cancer
    110330480 (Egfr)
   05231 Choline metabolism in cancer
    110330480 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330480 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110330480 (Egfr)
   05212 Pancreatic cancer
    110330480 (Egfr)
   05225 Hepatocellular carcinoma
    110330480 (Egfr)
   05226 Gastric cancer
    110330480 (Egfr)
   05214 Glioma
    110330480 (Egfr)
   05218 Melanoma
    110330480 (Egfr)
   05219 Bladder cancer
    110330480 (Egfr)
   05215 Prostate cancer
    110330480 (Egfr)
   05213 Endometrial cancer
    110330480 (Egfr)
   05224 Breast cancer
    110330480 (Egfr)
   05223 Non-small cell lung cancer
    110330480 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330480 (Egfr)
   05171 Coronavirus disease - COVID-19
    110330480 (Egfr)
   05163 Human cytomegalovirus infection
    110330480 (Egfr)
   05165 Human papillomavirus infection
    110330480 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330480 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110330480 (Egfr)
   01522 Endocrine resistance
    110330480 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110330480 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330480 (Egfr)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110330480 (Egfr)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110330480 (Egfr)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110330480 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   110330480 (Egfr)
  Exosomal proteins of bladder cancer cells
   110330480 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 110330480
NCBI-ProteinID: XP_021066267
Ensembl: MGP_PahariEiJ_G0016788
LinkDB
Position
13
AA seq 1210 aa
MRPSGTTRTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMETIQWRDIVQNVFLSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSRRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFRDEATCKDTCPPLMLYNPTTYQMDINPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGLRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDIHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITTLGLRSLKEISDGDVIISANRNLCYANTINWKKL
FGTPNQKTKIVSNRAEKDCKAMNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHVNCTYGCSGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFIRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDTFLQRYSSDPTGVVTED
NIDDAFLPAPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPAFWIQKDSHQMNLDNPDYQQDFSPKEAKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggaccacgagaaccacgttgctggtgctgctgaccgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattatgacctttccttcttaaag
accatccaggaggtggctggctatgtcctcatcgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctctatgaaaacacctatgccttagcc
atcctgtccaactacgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggag
actatccagtggagggacatcgtccaaaatgtctttctgagcaacatgtcaatggactta
cagagccacccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggcggaggagaagagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
cggcgttgtcgtggcaggtcccccagtgactgctgccacaaccagtgtgccgcggggtgt
acgggaccccgagagagtgactgtctggtctgccaaaagttccgagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccctaccacatatcagatggatatcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgtccccgaaactatgtg
gtgacagatcatggctcatgtgtccgggcctgtgggcctgactactacgaagtggaagaa
gatggcctccgaaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacgctctccataaatgctacaaatatcaaacacttcaaa
tactgcactgccatcagcggggacattcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgacctccatgctttt
gagaacctagaaattatacgtggcagaacaaagcaacatggtcagttttctctggcggtt
gtcggcctgaacatcacaacactggggttgcgttccctcaaggagatcagtgatggggat
gtgatcatttctgcaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcgtgagcaacagagctgagaaagactgcaag
gccatgaaccacgtctgcaatcctttatgctcctccgaaggctgctggggccctgagccg
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggataaatgcaac
atcctggagggggagccgagggagtttgtggaaaattcggaatgcatccagtgccatcca
gaatgtctgccccagaccatgaacatcacctgtacaggcagggggccagacaactgcatc
cagtgtgcccactatattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggggagaacaacaccctggtctggaagtatgcagatgccaataatgtctgccacctctgc
catgtcaactgtacctatggatgttctgggccaggtcttcaaggatgtgaagtatggcca
tctgggccaaagatcccatctatcgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatccgaaggcgtcacattgtccgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcaggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaggaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtgtgccgcctcctg
ggcatctgtctgacctccaccgtccagctcatcacacagctcatgccctatggttgcctc
ctggactatgtccgagaacacaaggacaacattggctcccagtacctactcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgctcggtgctgaagagaaagaatatcacgcagaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagcgatgtctgg
agttatggagtcaccgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
cccgcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccattgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgcgagttgattcttgaattctccaaaatggcccgagacccacaacgctac
cttgttatccagggggatgaaagaatgcatttgccaagcccgacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccatccacatcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccacagtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacaccttcttgcagcggtacagctccgaccccacaggcgttgtaacagaggac
aacatagatgacgcattcctccctgcacctgaatatataaaccaatctgttcccaagagg
ccagcaggctctgtacagaaccccgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccatagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcattctggatccagaaa
gacagccaccaaatgaacctagacaaccctgactaccagcaggacttctcccccaaggaa
gccaagccaaatggcatctttaagggccccacagcggaaaatgcagagtacctacgggtg
gcacctccaagcagcgagtttattggagcatga

KEGG   Mus pahari (shrew mouse): 110331028
Entry
110331028         CDS       T05929                                 

Symbol
Pdgfra
Name
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04144  Endocytosis
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331028 (Pdgfra)
   04014 Ras signaling pathway
    110331028 (Pdgfra)
   04015 Rap1 signaling pathway
    110331028 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110331028 (Pdgfra)
   04020 Calcium signaling pathway
    110331028 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110331028 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110331028 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110331028 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110331028 (Pdgfra)
   04540 Gap junction
    110331028 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110331028 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331028 (Pdgfra)
   05206 MicroRNAs in cancer
    110331028 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110331028 (Pdgfra)
   05231 Choline metabolism in cancer
    110331028 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110331028 (Pdgfra)
   05218 Melanoma
    110331028 (Pdgfra)
   05215 Prostate cancer
    110331028 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110331028 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110331028 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331028 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110331028 (Pdgfra)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110331028 (Pdgfra)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110331028 (Pdgfra)
CD molecules [BR:mpah04090]
 Proteins
  110331028 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 LMBR1 ExbD Kinase-like
Other DBs
NCBI-GeneID: 110331028
NCBI-ProteinID: XP_021067003
Ensembl: MGP_PahariEiJ_G0017089
LinkDB
Position
13
AA seq 1089 aa
MGTSHGVFLVLSCLLTGPGLIFCQLLLPSILPNENERIVQLNSSFSLRCLGESEVSWQHP
MSEEEDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVLASYDSRQGFNG
TFSVGPYVCEATVKGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIKPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYESKLKLIRAKEEDSGHYTIIVQNDDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCIAEGTPLPDINWMICKDIKKCNNDTSWTVLASNVSNIITELPRRS
RSTVEGRVSFAKVEETIAVRCMAKNNHSFVTRELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKSKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRPLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKVHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccacggggtctttctggtcctcagctgtctcctcacagggccgggcctc
atcttctgccagctcctattaccctctatcctcccaaatgagaatgagaggattgtgcag
ctgaattcgtccttttctctgagatgccttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccaacgtggaaatcaggaatgaggaaaacaacagtggcctc
tttgtcacagtgctggaagtggtcaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagaccgatgagagtgagatcgagggcaggcacatttatatctat
gtaccagacccagacatggcctttgtgcctctcgggatgacagattctttagtcatcgtg
gaagaggatgattctgccatcataccttgtcgcaccacagatccggagactcaagtcacc
ttgcacaataacgggaggctggtgcttgcctcctatgacagcaggcagggcttcaacggg
accttcagcgtggggccttacgtctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaacgtttacgccttgaaagcaacgtcagaactgaatctggagatggacaca
cgacagaccgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaat
gaggtcgttgatctgcagtggacttaccccggagaagtgagaaacaaaggcatcaccatg
ttggaggagatcaaactcccatccatcaaactggtgtacactttgactgtccccaaggcc
acggtgaaggacagcggagagtatgaatgcgctgcccgtcaggccacgaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtggagatcaagcccacc
tttggccagctggaagctgtcaacttgcatgaagtcagagaatttgtggtggaggtgcag
gcctacccgacacccaggatatcgtggctgaaggacaacttgactctaatagagaatctc
accgagatcaccaccgacgtacagaagagccaggaaacaaggtatgaaagcaaattaaag
ctgattcgcgctaaggaagaagacagtggccattacaccattatagttcaaaatgacgat
gacgtgaagagttacacgtttgagctgtcaactctagttcctgcgtccattctggagctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgcatagctgaaggcacc
cctcttccggacatcaactggatgatctgcaaggatattaagaaatgtaataatgatact
tcatggaccgttttggccagcaatgtctcgaatattatcacagagctccctcgccgcagc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagaaaccatcgcagttcga
tgcatggcaaagaacaaccacagctttgtgacccgggaactgaagctggtggctcccacc
ctgcgatctgaactcacagtggcggccgcagtgctggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gtcatcgagtcgatcagccccgacggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccaagagatggcctagtgcttggtcggattttggga
tccggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaagct
ctcatgtccgagctgaagataatgactcacttggggccgcatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagaatactgtttctatggg
gacttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagaaaag
tcaaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataatggcgactacatggacatgaagcaagccgacaccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaagtactctgacatccagagaccg
ctgtacgatcggccggcctcctacaagaagaaatccatgctagactcagaagtaaaaaac
ctcctttctgacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgcccgagggatggaatttttggcttcaaaaaattgtgtccaccgggacctggct
gcccgcaacgttctcctggcgcaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gttgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctacgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttttaccacctcagcgagatagtggagaatctgctgcctggacaatacaagaag
agttatgaaaaggttcacctggacttcctaaagagtgaccatccggctgtggcacgcatg
cgcgtggactctgataacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctg
aaggactgggaagggggcctggacgaacagagactgagcgcagacagcggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaagatgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcagacctggtggaggacagcttcctgtaa

KEGG   Mus pahari (shrew mouse): 110333065
Entry
110333065         CDS       T05929                                 

Symbol
Pdgfrb
Name
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333065 (Pdgfrb)
   04014 Ras signaling pathway
    110333065 (Pdgfrb)
   04015 Rap1 signaling pathway
    110333065 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    110333065 (Pdgfrb)
   04020 Calcium signaling pathway
    110333065 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    110333065 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    110333065 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110333065 (Pdgfrb)
   04540 Gap junction
    110333065 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333065 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333065 (Pdgfrb)
   05206 MicroRNAs in cancer
    110333065 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    110333065 (Pdgfrb)
   05231 Choline metabolism in cancer
    110333065 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    110333065 (Pdgfrb)
   05218 Melanoma
    110333065 (Pdgfrb)
   05215 Prostate cancer
    110333065 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333065 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110333065 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333065 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110333065 (Pdgfrb)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110333065 (Pdgfrb)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110333065 (Pdgfrb)
CD molecules [BR:mpah04090]
 Proteins
  110333065 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C2-set_2
Other DBs
NCBI-GeneID: 110333065
NCBI-ProteinID: XP_021070125
Ensembl: MGP_PahariEiJ_G0019048
LinkDB
Position
15
AA seq 1099 aa
MGLPGVMPASVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQETAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGSELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPRLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDKEVDSDTYYVYSLQVSSINVSVNAMQTVVRRGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINITVIENGYVRLLETLGDVQIAELHRSRTLQVELEAYPTPSVLWLKDNRTLGDSS
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKSRCPRKLSPTPLGNSSKEESQLETNV
TFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKVVVISTILA
LVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNAL
PVGFSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSSYMAPYDNYVP
SAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDND
YIIPLPDPKPDAADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLE
QPQDSGCPEPLAEAEDSFL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggggcttccaggagtgatgccagcttcagtcctcagaggccagttgctgctctccgtg
ctatggctcctgggaccgcagacctcccggggcctagtcatcacgccccctgggccagag
tttgtcctcaacatctccagcacctttgttctgacctgctcgagttcagctcctgtgatg
tgggaacagatgtcccaggtgccctggcaagaaacggccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcaccgggggagacactggggaatacttttgtgtc
tacaacaactcactagggtcagagctcagtgagaggaagcgtatctatatcttcgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccggctggaggtgacgctgcat
gagaagaaagtggatatccccctacatgtaccctacgaccaccaacgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacaaggaagtggattcc
gatacttactacgtctacagcctccaggtgtcatccatcaatgtctctgtgaatgccatg
cagactgtggtccgccggggtgagagcatcactatcaggtgcattgtgatgggcaatgat
gtggtcaacttccagtggacttacccccgcatgaagagtgggcgactggtggagccagtg
acagactacctttttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgactcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatggc
gacgagaaagccatcaacatcactgtgatcgagaatggctacgtgcggctgctggaaaca
ctgggagatgtacagattgctgagctgcaccggagccggacgctgcaggtggagttggag
gcttatccgacgccctcggtcctgtggctcaaggacaaccgtaccttgggtgactccagc
gctggcgagttagttctgtctactcgcaacgtgtctgagacccggtacgtgtcagaactg
accttggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagccttccacgag
gatgacgaggtccagctctccttcaagctgcaggtcaatgtccctgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgtggccggggtatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaagcaggtgtccacgaaaa
ctgtcacccacacccttggggaatagttccaaagaggagagtcagctagaaacgaatgtg
actttctgggaggaagatcaggaatatgaggtggtgagcacactgcgcctgcgccacgtg
gaccagccactgtcggtacgctgtatgctgcagaactccatgggcagagattcgcaggag
gtcaccgtggtcccacattccttgcccttcaaagtggtggtgatctcaaccatcctggcc
ttagtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagcca
cgctatgagatccgatggaaggtcatcgagtctgtgagctctgacggtcatgagtacatc
tacgtggaccccgtgcagctgccttacgactccacctgggagctgccacgggaccagctt
gttctgggacggactcttggctctggggctttcggacaggtggtggaggccacggctcat
ggtctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatctacagcc
agaagtagtgagaagcaggccctcatgtcggagctgaagattatgagtcatctaggaccc
cacctgaacgtggtcaacctgctgggggcctgcaccaaaggaggtcccatctacatcatc
acggaatactgccgctacggcgacctggtggactacctacacaggaacaaacacaccttc
ttgcagcgacactccaacaagcattgtccacccagcgctgagctctacagcaacgccctg
ccggtggggttctccctacccagccacttgaacctgactggggagagcgatggtggttac
atggatatgagcaaggatgaatctgtagattacgtgcccatgttggacatgaaaggagac
atcaaatatgcagacattgagtcctccagctacatggccccttatgataactatgtccca
tctgcccctgaaaggacctatcgtgccaccttaatcaatgactcaccagtgctcagctac
acagacctcgtgggcttcagctaccaagtggccaatggcatggacttcttagcctctaag
aactgtgttcaccgagacctggcggccaggaatgtgctcatctgcgagggcaaactggtc
aagatctgtgacttcggcctggctcgagacatcatgagggactcaaactacatctccaaa
ggcagtaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctttac
accaccttgagcgatgtctggtcctttgggatcctgctctgggagatcttcacactgggt
ggcaccccttacccagagctgcccatgaatgaccagttctacaatgccatcaagaggggc
taccgcatggcccagcctgctcatgcctccgacgagatctatgagatcatgcaaaaatgc
tgggaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagagg
cttctgggtgaaggctataaaaagaagtaccagcaggtagatgaggagttcctgaggagt
gaccatccagccatcctgaggtcccaagcccgctttccaggaatccacagcctccgatcc
cctctggacaccagctctgtcctctacactgccgtgcagcccaatgagagtgacaatgac
tacatcatccccttacctgaccccaagcctgacgctgctgatgaaggtctcccagagggg
tcccccagccttgccagctccaccttgaatgaagtcaacacttcctccaccatctcctgt
gacagtcccctggagctccaagaagagccgcagcaagcagagcctgaggcacagctggag
cagccacaggattcaggatgcccagaacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus pahari (shrew mouse): 110336809
Entry
110336809         CDS       T05929                                 

Symbol
Fgfr1
Name
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04520  Adherens junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04714  Thermogenesis
mpah04810  Regulation of actin cytoskeleton
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05224  Breast cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110336809 (Fgfr1)
   04014 Ras signaling pathway
    110336809 (Fgfr1)
   04015 Rap1 signaling pathway
    110336809 (Fgfr1)
   04020 Calcium signaling pathway
    110336809 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    110336809 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110336809 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110336809 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110336809 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110336809 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110336809 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336809 (Fgfr1)
   05205 Proteoglycans in cancer
    110336809 (Fgfr1)
   05230 Central carbon metabolism in cancer
    110336809 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    110336809 (Fgfr1)
   05215 Prostate cancer
    110336809 (Fgfr1)
   05224 Breast cancer
    110336809 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110336809 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110336809 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110336809 (Fgfr1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110336809 (Fgfr1)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   110336809 (Fgfr1)
CD molecules [BR:mpah04090]
 Proteins
  110336809 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110336809 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 ABC1 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 110336809
NCBI-ProteinID: XP_021075216
Ensembl: MGP_PahariEiJ_G0021393
LinkDB
Position
19
AA seq 820 aa
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEVIIYSIGAFLISCMLGSVFIYKMKSGNKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPDEPCLPRHPTQLANGGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggggctggaagtgcctcctcttctgggctgtgctggtcacagccactctctgcact
gccaggccagccccaaccttgcccgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgcacccgt
atcacaggggaggaggtggaggtgcgggactccatccccgctgactctggcctctacgct
tgtgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcctcggaagatgatgatgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcacgcggtgcctgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagaattcaagcctgac
caccggattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcattaac
cacacctaccagcttgacgtcgtggaacgatctcctcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaacgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
ggtccagacaacttgccatatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagcgaccagctgtgatgacctccccgctctacctggaagtcattatctac
tccatcggggccttcctgatctcctgtatgttgggctctgtcttcatctacaagatgaag
agcggcaacaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagt
atccctctgcgcagacaggtgtcagctgactccagtgcatccatgaactctggggttctc
ctggttcgaccctcacggctctcctccagcgggacccccatgctagctggagtctccgaa
tatgagctccctgaggatccccgctgggagctgccacgagacagactggtcttaggcaaa
ccacttggtgagggctgcttcgggcaggtggtgttggccgaggccatcgggctggataag
gacaaacccaaccgcgtgaccaaagtggccgtgaagatgttgaagtccgatgcaacggag
aaggacctgtcggatctgatctcggagatggagatgatgaaaatgatcgggaaacacaag
aatatcatcaaccttctgggggcgtgcacacaggatggtcctctttatgtcatcgtggag
tacgcctccaaaggcaacctccgggagtatctgcaggcccggaggcctcctgggctggaa
tactgctacaaccccagccacaaccctgaggaacagctgtcttccaaagatctggtatcc
tgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtatacaccga
gacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgcagacttt
ggcttagctcgagacattcaccatatcgactactataagaaaaccaccaatggccggctg
cctgtgaagtggatggcccccgaggccttgtttgaccggatctacacccaccagagcgac
gtgtggtcttttggggtgctcttgtgggagatcttcactctgggtggctccccatacccc
ggtgtgcctgtggaagaacttttcaagctgctgaaggagggtcatcgaatggacaagccc
agtaactgtaccaatgagctgtacatgatgatgcgggactgctggcacgccgtgccctct
cagagacctacgttcaagcagctggtggaagacctggaccgcattgtggccttgacctcc
aaccaggagtatctggacctgtccataccgctggaccagtactcacccagctttcccgac
acacggagctccacctgctcctcaggggaggactctgtcttctctcatgagccgttacct
gacgagccctgtctgccccgacaccctacccagcttgccaacggtggactcaaacggcgc
tga

DBGET integrated database retrieval system