KEGG   Mus pahari (shrew mouse): 110316106
Entry
110316106         CDS       T05929                                 
Symbol
Vwf
Name
(RefSeq) von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah05165  Human papillomavirus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110316106 (Vwf)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110316106 (Vwf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110316106 (Vwf)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110316106 (Vwf)
   04611 Platelet activation
    110316106 (Vwf)
   04613 Neutrophil extracellular trap formation
    110316106 (Vwf)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110316106 (Vwf)
   05165 Human papillomavirus infection
    110316106 (Vwf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110316106 (Vwf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110316106 (Vwf)
Chaperones and folding catalysts [BR:mpah03110]
 Intramolecular chaperones
  Others
   110316106 (Vwf)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110316106 (Vwf)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC Pacifastin_I MCR_beta_N
Other DBs
NCBI-GeneID: 110316106
NCBI-ProteinID: XP_021045854
Ensembl: MGP_PahariEiJ_G0022643
LinkDB
Position
2:140639342..140793758
AA seq 2816 aa
MGKMNPFRYEICLLVLALTWPGTLCTEKPSDRPLTARCSLFGDDFINTFDETMYSFAGDC
SYFLAGDCQKHSFSILGNFQDGKRMSLSVYLGEFFDIHLFANGTVMQGDQSISMPYASQG
LYLELEAGYYKLSSEAFGFAARIDGNANFQVLLSDRHFNKTCGLCGDFNIFAEDDFRTQE
GTLTSDPYDFANSWALSSEEERCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARC
HPLVDPEPFVALCEKTLCTCVTGPECACPVLLEYARTCAQEGMVLYGWTDHGACRPACPA
GMEYKECVSPCPRTCQSLPFNEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVHAGKRY
PPGTSLSQDCNTCICRNSLWICSNEDCPGECLVTGQSHFKSFDDRYFTFSGICQYLLARD
CEDHSFSIIIETMQCADDPDAVCTRWVSVRLSALHNSLVKLKHGGGVAIDGQDVQIPFLQ
GDLRIQHTVMASVRLSYGEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLT
PAGLVEPLVVDFGNAWKLQGDCPDLHRQHSDPCSLNPRLTRFAEEACALLTSSKFEACHR
AVSPLPYLQNCRYDVCACSDGRDCLCNAVANYAAACARKGVHIGWREPGFCALGCPLGQV
YLQCGNSCNLTCRSLSLPDEECSEVCLEGCFCPPGLYQDERGDCVPKAQCPCYYDGELFQ
PADIFSDHHTMCYCEDGFMHCTTSGAPGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCP
ADNPRAQGLECAKTCQNYDLECMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGEEYA
PGDTVTIGCNTCVCRERKWNCTNHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDY
CGSNPGTFQILVGNEGCSYPSVTCRKRVTILVEGGEIELFDGEVNVKRPLRDESHFEVVE
SGRYVILLLTQALSVVWDHHLSISVVLQHTYQEQVCGLCGNFDGIQNNDFTSSSLQVEED
PINFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSNTFQSCNRLVDP
EPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVIAWRTSTLCPQSCEERNVRE
NGYECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPQDCP
VCEVAGRRLAPGKKITLSPDDPTHCQNCHCDGVNLTCEACQEPGGLVVPPTDAPVSSTTP
YVEDTPEPPLHNFYCSKLLDLVFLLDGSSMLSEAEFEVLKAFVVGMMERLHISQKRIRVA
VVEYHDGSRAYLELKARKRPSELRRITSQIKYTGSQVASTSEVLKYTLFQIFGKIDRPEA
SHITLLLTASQEPPRMARNLVRYVQGLKKKKVIVIPVGIGPHASLKQIRLIEKQAPENKA
FLLSGVDELEQRRDEIISYLCDLAPEAPAPTQPPQVAHVTMSPGVSGISSPGPKRKSMVL
DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDETRISVLQYSYTVTVEYTFNEAQS
KEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPIQGDRVQAPNLVYMVTGNPASDEIK
RLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLVLQTCCSKEGLQL
PTLPPLPDCSQPLDVVLLLDGSSSLPESSFDKMKSFAKAFISKANIGPHLTQVSVIQYGS
INTIDVPWNVAQEKAHLQSLVDLMQQEGGPSQIGDALAFAVRYVTSQIHGARSGASKAVV
IVVMDTSLDPVDTAADAARSNRVTVFPIGVGDRYDEAQLRMLAGPGASSNVVKLQRVEDL
STMAALGNSFFHKLCSGFSGVCVDEDGNEKKPGDVWTLPDQCHTVTCLANGQTLLQSHRV
NCDHGPRPSCSNSQSPVRVEETCGCRWICPCVCTGSSTRHIVTFDGQNFKLTGSCSYIVF
QNKEQDLEVLLHNGACSPGAKQACMKSIEVKHAGLSVELHSNMEMAVNGRLVLAPYVGGN
MEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMYGLCGICDENGANDFT
LRDGTVTTDWKRLIQEWTVQQPGYTCQSVPEEQCPISDSSHCQVLLSASFAECHKVIAPA
TFHTICQQDSCHQERVCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCP
QRCDGNTSFCGDHPSEGCFCPQHQVLLEGSCVPEEACTQCVGEDGVRHQLLETWVPDHQP
CQICMCLSGRKINCTAQPCPTARAPTCGPCEVARLKQSANLCCPEYECVCDLVNCNLPPV
PPCEEGLQPTLTNPGECRPTFTCACRKEECKRAPPPSCPPHRTPTLRKTQCCDEYECACN
CVNSTLSCPLGYLASATTNDCGCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCTCTDME
DTVVGLRVVQCSQRPCEDSCQPGFSYVLHEGECCGRCLPSACKVVAGSLRGDSHSSWKSV
GSRWAVPENPCLVNECVRVEDAVFVQQRNISCPQLAVPTCPTGFQLNCETSECCPSCHCE
PVEACLLNGTIIGPGKSVMVDLCTTCRCIVQTGAMSRFKLECRKTTCEACPMGYREEKSQ
GECCGRCLPTACTIQLRGGRIMTLKQDETFQDGCDSHLCRVNERGEYIWEKRVTGCPPFD
EHKCLAEGGKIVKIPGTCCDTCEEPDCKDITAKVQYIKVGDCKSQEEVDIHYCQGKCASK
AVYSIDIEDVQEQCSCCRPSRTEPMRVPLHCTNGSVVYHEVINAMQCRCSPRNCSK
NT seq 8451 nt   +upstreamnt  +downstreamnt
atggggaagatgaacccttttaggtatgagatctgcctgcttgttctggccctcacctgg
ccagggaccctctgcacagaaaagcccagtgacaggccgttgacagctcgatgcagcctc
tttggggacgacttcatcaacacgtttgatgagaccatgtacagctttgcaggggactgc
agttatttcctggctggggactgccagaaacattccttctccattctcgggaacttccaa
gatggcaagagaatgagcctgtctgtgtatcttggggagttttttgacatccatttgttt
gccaatggcaccgtaatgcagggggaccaaagcatctccatgccctacgcctcccaagga
ctctacctagaactcgaggctgggtactataagctttccagcgaggcctttggctttgcg
gccagaatcgatggaaatgccaacttccaagtcctgctgtcagacagacacttcaacaag
acctgtgggctgtgcggtgactttaacatcttcgccgaggatgactttaggacacaggag
gggaccttgacctcagacccctatgactttgccaactcctgggccctgagcagtgaggaa
gagcggtgtaaacgggcatctcctcccagcaggaactgcgagagctcctctggggacatg
catcaggccatgtgggagcaatgccagctactgaagacggcatcagtgtttgcccgctgc
caccctctggtggatcccgagccctttgtggctctgtgtgagaagactttgtgtacgtgc
gtcacggggccagagtgcgcatgtcctgttctccttgagtatgcccgaacctgcgcccag
gaagggatggtgctgtacggctggactgaccatggcgcctgtcgtccagcttgcccagct
ggcatggaatataaggagtgtgtgtctccttgccccagaacctgccagagcctgcctttc
aatgaagtgtgtcagcagcaatgtgtagacggctgtagctgccctgagggagagctcttg
gatgaagaccgctgtgtgcagagctccgactgtccttgcgtgcacgctgggaagcggtac
cctcctggcacctctctctctcaggactgcaacacttgcatctgcagaaacagcctatgg
atctgcagcaatgaggactgcccaggggagtgtcttgtcacaggccaatcgcacttcaag
agcttcgacgacaggtacttcaccttcagtgggatctgccaatacctgctggcccgggac
tgcgaagatcactctttctccattatcatagagaccatgcagtgtgccgatgaccctgat
gctgtctgcacccgctgggtcagtgtgcgactgtctgccctgcacaacagcctcgtgaaa
ctgaagcatgggggaggagtggccatcgatggccaggatgtccagatccccttcctgcaa
ggtgacctccgcatccagcacacagtgatggcttctgtacgccttagctacggggaggac
ctgcagatggactgggatggccgcgggcggttactggttaagctgtccccagtctattct
gggaagacctgtggcttgtgtgggaattacaacggcaacaagggagacgacttcctcacg
ccggcgggcttggtggagcccctggtggtagacttcggaaacgcctggaagcttcaaggg
gactgtccggacctgcacaggcaacacagcgacccctgcagcctgaacccacgcttgacc
aggtttgcggaggaggcttgcgcgctcctgacgtcctccaagttcgaggcctgccaccgc
gcagtcagccctctgccctacctgcagaactgccgttacgatgtttgcgcctgctccgac
ggccgggattgcctgtgtaacgcagtagctaactatgctgccgcgtgtgcccgaaaaggc
gtgcacatcgggtggcgggagcccggcttctgtgctctgggctgtccactgggccaggtg
tacctgcagtgcgggaattcctgcaacctgacctgccgctccctctccctcccggatgaa
gaatgcagtgaagtctgtcttgaaggctgcttctgccccccagggctctaccaggatgaa
agaggggactgtgtgcccaaggcccagtgcccctgctactatgatggtgagctcttccag
cctgcggacattttctcagaccaccataccatgtgttactgcgaagatggcttcatgcac
tgtaccacaagtggagccccggggagcctgttgcctgacactgtcctcagcagccccctg
tctcaccgcagcaaaaggagcctctcctgccggccacccatggtcaagctggtgtgtccc
gctgacaacccacgggctcaagggctggagtgtgctaagacttgccagaactacgacctg
gagtgtatgagcctgggctgtgtgtctggctgcctctgtcccccaggcatggtccggcat
gaaaacaagtgtgtggccttggagcggtgtccctgcttccaccagggtgaggagtatgcc
ccgggagatacagtgacaatcggctgcaacacctgtgtctgccgggagcggaagtggaac
tgcacgaaccacgtgtgtgacgccacttgctctgccattggtatggcccactacctcacc
tttgatggactcaagtacctcttcccgggggagtgccagtatgttctggtgcaggattac
tgtggcagtaaccctgggacctttcagatcctggtggggaatgagggttgcagctatccc
tcggtgacgtgcaggaagcgggtgaccatcctggtggaaggaggggagattgaactgttt
gacggagaggtgaatgttaagaggcccctgagagatgagtcgcactttgaggtggtggag
tcgggccggtacgtcatcctgctgctgactcaggccctttctgtggtctgggaccaccac
ctcagcatctctgtggtcctgcagcacacataccaggaacaggtgtgtggcctgtgcggg
aacttcgatggcatccagaacaatgacttcaccagcagcagcctccaggtggaggaagac
cccatcaactttgggaactcctggaaagtgagctcacagtgtgccgacacaagaaagctg
tcactagacgtttcccctgccacctgccacaacaacatcatgaaacagacgatggtggac
tcagcctgcagaatccttaccagcaacaccttccagagctgcaataggctggtggacccc
gagccatacctggacatctgtatttatgacacttgctcctgtgagtccattggggactgc
gcctgtttctgtgacaccatcgctgcctatgcccacgtgtgtgcccagcatggccaggtg
atagcctggaggacatccacactgtgcccccagagctgtgaagaaaggaatgttcgggaa
aatggctatgagtgcgagtggcgttacaacagctgtgcgcccgcttgcccagtcacgtgt
cagcaccccgagcctctggcttgccctgtgcagtgtgtggagggttgtcacgcacactgc
cctccagggaaaatcctggatgaacttctgcagacctgtgtagacccccaagactgcccc
gtgtgtgaggtggctggtcggcgcttggctcccggaaagaaaataaccttgagtcctgat
gaccctacgcactgtcagaattgtcactgtgatggtgtgaaccttacgtgtgaagcctgc
caagaacccggaggcctggtggtacccccaacggatgccccagtcagctctaccaccccg
tatgttgaggacacccccgagccccccctgcacaacttctactgcagcaagctgctcgat
cttgtcttcctgctggatggctcctccatgctgtctgaggctgagtttgaagtgctcaaa
gcttttgtggtgggcatgatggagaggctacacatctctcagaagcgcattcgcgtggca
gtggtagagtaccacgacggctcccgtgcctaccttgagctcaaggcccggaagcgaccc
tcagagcttcggcgcatcaccagccagattaagtatacagggagccaggtggcctctacc
agcgaggttttgaagtacacactattccagatctttggcaaaattgatcgtcctgaagcc
tcccatatcactctgctcctgactgccagccaggagcccccacggatggctaggaatttg
gtccgctatgtccaaggtctgaagaagaagaaggttatcgtgatccctgtgggcattggg
ccgcatgccagcctcaaacagatccgcctcatcgagaagcaggcccctgaaaacaaggcc
tttctgctcagtggggtggatgagctggagcagagaagagatgagataatcagttacctc
tgtgaccttgctcccgaggccccagccccaactcagcctccacaggtagcccacgtcacc
atgagtccaggggtctctgggatctcatcgccgggaccaaaaaggaagtccatggttctg
gatgtggtgtttgtcctggaggggtcagacgaagttggtgaagccaacttcaataagagc
aaggagtttgtggaggaggtaatccagcgcatggatgtgagcccggatgaaacgcgcatc
tcggtactgcagtattcctacacggtaaccgtggagtacaccttcaatgaggcccagtcc
aaggaggaggtgctgcggcacgtacgagagatccgctaccagggcggcaataggacaaac
actgggcaggccctgcagtacctttctgagcacagcttctctcccatccaaggggaccgg
gtacaggcacctaacctggtctacatggtcacggggaaccctgcctctgatgagatcaag
aggttgcctggagacatccaggtggtacccattggggtgggcccccatgccaacatgcag
gaactagagaggatcagcagacccattgctcccatcttcatccgggactttgagacactt
ccccgagaggctcctgacctggtcctgcagacatgctgctccaaggagggtctgcaactg
cccaccctcccccctctccctgactgcagccaacccctggatgtggtcctgctcctggat
ggctcctctagcttgccagagtcttcctttgataaaatgaagagttttgccaaggctttc
atttcgaaggccaacattgggccccacctcactcaggtgtctgtgatacagtacggaagc
atcaataccattgacgtgccgtggaatgtggcccaggagaaagcccatctgcagagtttg
gtggacctcatgcagcaggagggcggccccagccagattggggatgctctggcctttgcc
gtgcgctatgtaacgtcacaaatccatggagccaggtccggagcctccaaagcagtggtc
atcgtcgtcatggatacctccttggatccggtggacacagcagcggatgctgccagatcc
aaccgagtgacagtgttccccattggggttggggatcggtatgatgaagcccagctgagg
atgttggcaggccctggggccagctccaatgtggtaaagctccagcgagttgaagacctc
tccaccatggccgccctgggcaactccttcttccacaaactgtgttctgggttttctggg
gtttgtgtggatgaagatgggaatgagaagaagcctggggatgtctggaccttgccagat
cagtgccacacagtgacttgcttggcaaatggccagaccttgctgcagagtcatcgggtc
aattgtgaccatggaccccggccttcatgttccaacagccagtctcctgtccgggtggag
gagacatgtggctgccgctggatctgtccttgtgtgtgcacgggcagttccactcggcac
atcgtcaccttcgatgggcagaatttcaagcttactggcagttgctcctacatcgtcttt
caaaacaaggagcaggacctggaagtgctcctccacaatggggcctgcagccccggggca
aagcaagcctgcatgaagtccattgaggttaagcatgctggcctctctgttgagctgcac
agtaacatggagatggcagtgaatgggagactggtccttgccccgtatgtgggtggaaac
atggaagtcagcatctacggcgctatcatgtatgaagtcaggtttacccatcttggccac
atcctcacttacacgccacagaacaacgagttccaactgcagcttagccccaagaccttt
gcttcaaagatgtatggtctctgtggaatctgtgatgaaaacggggccaatgacttcacg
ttgcgagatggcacggtcaccactgactggaaaaggcttatccaggaatggacggtgcag
cagccagggtacacatgccagtctgttcctgaggagcagtgtcccatttctgacagctcc
cactgccaggtcctcctctcagcatcgtttgctgaatgccacaaggtcatcgctccagcc
acattccataccatctgccagcaagacagttgccaccaggagcgagtgtgtgaggtgatt
gcttcttatgcccatctctgccggaccagtggggtctgtgttgattggaggacaactgac
ttctgtgctatgtcatgcccaccgtctctggtgtataaccactgtgagcgtggctgccct
cagcgctgcgatgggaacactagcttctgtggggaccacccctcagaaggctgcttctgt
ccccaacaccaagtcttgctggaaggtagctgtgtccccgaggaggcctgcactcagtgt
gttggcgaggatggagtccgacatcagctcctagagacctgggtcccagaccatcagccc
tgtcagatctgtatgtgcctcagtgggaggaagattaactgcactgcccagccgtgtccc
acagcccgagctcccacgtgtggcccgtgtgaagtggctcgcctcaagcagagcgcaaac
ctgtgctgcccagagtatgagtgtgtgtgtgacctggtcaactgcaacttgcctccagtg
cctccgtgtgaagaagggctccagccaaccctgaccaaccctggagaatgcagacccacc
tttacctgtgcctgcaggaaagaagagtgcaaaagagcgcccccaccctcctgcccccct
caccggacacccacccttcggaagacccagtgctgtgatgaatacgagtgtgcttgcaac
tgtgtcaactccacactgagctgcccacttggctacctggcctcggccactaccaacgac
tgcggttgcactacgaccacctgtcttcctgacaaggtttgtgtccaccgaggcaccatc
taccctgtgggccagttctgggaggagggctgtgacacgtgcacctgtacggacatggag
gatactgtggtgggcctgcgtgtggtccagtgctctcaaaggccctgtgaagacagctgt
cagccaggtttttcttacgttctccacgaaggcgagtgctgtggaaggtgcctgccctct
gcttgcaaggtggtggctggctcactgcggggcgattcccactcttcctggaaaagcgtt
ggatctcggtgggctgttcctgagaacccctgcctcgtcaatgagtgtgtacgcgtggag
gatgcagtgtttgtgcagcagaggaacatctcctgcccacagctggctgtccctacctgt
cccacaggcttccagctgaactgcgagacctcagagtgctgtcccagctgccactgtgag
cctgtggaggcctgcctgctcaatggcaccatcattgggcccgggaagagtgtgatggtt
gacctatgcacgacctgccgctgcatcgtgcagacaggtgccatgtccagattcaagctg
gagtgccgaaagactacctgtgaggcctgccccatgggctatcgggaagagaagagccag
ggtgaatgctgcgggagatgcttgcctacagcttgcactattcagctaagagggggacgg
atcatgaccctgaagcaagatgagacattccaggatggctgtgacagtcacttgtgcagg
gtcaacgagagaggagagtacatttgggagaagagggtcacgggctgcccaccattcgat
gaacacaagtgtctggctgaaggaggcaaaatcgtgaaaattccaggcacctgctgtgac
acatgtgaggagcctgattgcaaagacattacagccaaggtgcagtacatcaaagtggga
gattgtaagtcccaagaggaagtggacattcattactgccagggaaagtgtgccagcaaa
gcagtgtactccattgacatcgaggatgtgcaggagcaatgctcctgctgccggccctcg
aggacggagcccatgcgtgtgcccttgcactgcaccaatggctctgtcgtgtaccatgag
gtcatcaacgccatgcagtgcaggtgttctccccggaactgcagcaagtga

DBGET integrated database retrieval system