KEGG   Mus pahari (shrew mouse): 110316152
Entry
110316152         CDS       T05929                                 
Symbol
Creb3l2
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110316152 (Creb3l2)
   04024 cAMP signaling pathway
    110316152 (Creb3l2)
   04022 cGMP-PKG signaling pathway
    110316152 (Creb3l2)
   04151 PI3K-Akt signaling pathway
    110316152 (Creb3l2)
   04152 AMPK signaling pathway
    110316152 (Creb3l2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110316152 (Creb3l2)
   04922 Glucagon signaling pathway
    110316152 (Creb3l2)
   04915 Estrogen signaling pathway
    110316152 (Creb3l2)
   04926 Relaxin signaling pathway
    110316152 (Creb3l2)
   04935 Growth hormone synthesis, secretion and action
    110316152 (Creb3l2)
   04918 Thyroid hormone synthesis
    110316152 (Creb3l2)
   04928 Parathyroid hormone synthesis, secretion and action
    110316152 (Creb3l2)
   04916 Melanogenesis
    110316152 (Creb3l2)
   04925 Aldosterone synthesis and secretion
    110316152 (Creb3l2)
   04927 Cortisol synthesis and secretion
    110316152 (Creb3l2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110316152 (Creb3l2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110316152 (Creb3l2)
  09156 Nervous system
   04725 Cholinergic synapse
    110316152 (Creb3l2)
   04728 Dopaminergic synapse
    110316152 (Creb3l2)
  09149 Aging
   04211 Longevity regulating pathway
    110316152 (Creb3l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110316152 (Creb3l2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110316152 (Creb3l2)
   05203 Viral carcinogenesis
    110316152 (Creb3l2)
  09162 Cancer: specific types
   05215 Prostate cancer
    110316152 (Creb3l2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110316152 (Creb3l2)
   05161 Hepatitis B
    110316152 (Creb3l2)
   05163 Human cytomegalovirus infection
    110316152 (Creb3l2)
   05165 Human papillomavirus infection
    110316152 (Creb3l2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110316152 (Creb3l2)
   05020 Prion disease
    110316152 (Creb3l2)
  09165 Substance dependence
   05030 Cocaine addiction
    110316152 (Creb3l2)
   05031 Amphetamine addiction
    110316152 (Creb3l2)
   05034 Alcoholism
    110316152 (Creb3l2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110316152 (Creb3l2)
   04934 Cushing syndrome
    110316152 (Creb3l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110316152 (Creb3l2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110316152 (Creb3l2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS6_N TPR_MLP1_2
Other DBs
NCBI-GeneID: 110316152
NCBI-ProteinID: XP_021045910
Ensembl: MGP_PahariEiJ_G0021982
LinkDB
Position
2:complement(56664173..56773607)
AA seq 521 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLSEEPRTQSPFTHAATSDSFNDEEVESEKWYLSTEF
PSATIKTEPITEEQPPGLVPSVTLTITAISTPFEKEESPLDMNAGGDSSCQTLIPKIKLE
PHEVDQFLNFSPKEASVDQLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLSQAHSPARAMP
RGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQAL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHPLSEPYT
ASVVRSRNLLIYEEHSPLEESSSPASAGELGGWDRGPSLLRASSGLESLPEVDLPHFIIS
NETSLEKSVLLELQQHLVGSKLEGNETLKVVELERRVNATF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggagagactgaggccctcatgtaccacacgcacttctcggagctcctg
gatgagttttcccagaacgtcctgggccagctcctgaatgaccctttcctctcagagaag
agcgtgtcgatggaggtggagccatctccaacatcaccagcacctctcatccaggctgaa
cacagctactctctgagcgaggagccccggactcagtcaccatttacccatgcggctacc
agcgacagcttcaatgatgaggaggtggagagtgagaaatggtacctgtctacagagttt
ccttcagctaccatcaagacagagccaatcacagaggagcagcccccgggacttgtccct
tctgtcactctgaccatcacagccatttccactccttttgaaaaagaagagtcccctctg
gatatgaatgctgggggggactcctcatgccagacacttatccctaagattaagctggag
ccacatgaagtggatcagttcttaaacttctctccaaaagaagcctccgtggatcaactg
cacttaccaccaacaccacccagtagtcacagcagtgactctgagggcagcttgagcccc
aacccacgcctgcatcccttcagcctgtctcaggcccacagccctgccagagccatgccc
cggggcccctctgccttgtccacatctcctctcctcacagctccacataagctgcaggga
tcgggccccctggtcctgacggaggaggagaagaggaccttggttgctgagggctatccc
attcccaccaagctgcccctgacgaaatctgaggagaaggccctaaagaaaatccggaga
aagatcaagaataagatttctgcccaagaaagcaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaacagagaacttggagcttcggaagaaggtg
gaggtgctggagaacaccaataggactctccttcagcaacttcagaagcttcaggctttg
gtgatggggaaggtctctcgaacctgcaagttagctggcacacagactggcacctgcctc
atggtcgttgtgctttgctttgctgtggcatttggcagcttctttcaaggctacgggcct
tatccttctgccaccaagatggctctgcccagccagcatcctctgtcggagccatacaca
gcctccgtggtgagatccaggaacctgctaatctatgaggaacactctcccctggaagag
tcgtccagcccagcctcagcaggggagctggggggctgggacagaggcccctctctgctc
agggcatcgtccgggcttgagtccctgccagaagtggatcttccccattttattatctct
aatgagaccagcttggagaagtcagtactgttggagcttcagcagcacctggtcggcagc
aaactggaagggaatgaaacactcaaggtcgtagaactggagaggagagtgaacgccacc
ttctga

KEGG   Mus pahari (shrew mouse): 110318364
Entry
110318364         CDS       T05929                                 
Symbol
Creb3l1
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110318364 (Creb3l1)
   04024 cAMP signaling pathway
    110318364 (Creb3l1)
   04022 cGMP-PKG signaling pathway
    110318364 (Creb3l1)
   04151 PI3K-Akt signaling pathway
    110318364 (Creb3l1)
   04152 AMPK signaling pathway
    110318364 (Creb3l1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110318364 (Creb3l1)
   04922 Glucagon signaling pathway
    110318364 (Creb3l1)
   04915 Estrogen signaling pathway
    110318364 (Creb3l1)
   04926 Relaxin signaling pathway
    110318364 (Creb3l1)
   04935 Growth hormone synthesis, secretion and action
    110318364 (Creb3l1)
   04918 Thyroid hormone synthesis
    110318364 (Creb3l1)
   04928 Parathyroid hormone synthesis, secretion and action
    110318364 (Creb3l1)
   04916 Melanogenesis
    110318364 (Creb3l1)
   04925 Aldosterone synthesis and secretion
    110318364 (Creb3l1)
   04927 Cortisol synthesis and secretion
    110318364 (Creb3l1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110318364 (Creb3l1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110318364 (Creb3l1)
  09156 Nervous system
   04725 Cholinergic synapse
    110318364 (Creb3l1)
   04728 Dopaminergic synapse
    110318364 (Creb3l1)
  09149 Aging
   04211 Longevity regulating pathway
    110318364 (Creb3l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110318364 (Creb3l1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110318364 (Creb3l1)
   05203 Viral carcinogenesis
    110318364 (Creb3l1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110318364 (Creb3l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110318364 (Creb3l1)
   05161 Hepatitis B
    110318364 (Creb3l1)
   05163 Human cytomegalovirus infection
    110318364 (Creb3l1)
   05165 Human papillomavirus infection
    110318364 (Creb3l1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110318364 (Creb3l1)
   05020 Prion disease
    110318364 (Creb3l1)
  09165 Substance dependence
   05030 Cocaine addiction
    110318364 (Creb3l1)
   05031 Amphetamine addiction
    110318364 (Creb3l1)
   05034 Alcoholism
    110318364 (Creb3l1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110318364 (Creb3l1)
   04934 Cushing syndrome
    110318364 (Creb3l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110318364 (Creb3l1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110318364 (Creb3l1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 DUF4337 Jnk-SapK_ap_N TPR_MLP1_2 ELP6 APG6_N ADIP JIP_LZII JMY RNase_Y_N
Other DBs
NCBI-GeneID: 110318364
NCBI-ProteinID: XP_021049015
Ensembl: MGP_PahariEiJ_G0025411
LinkDB
Position
3:complement(77132223..77173919)
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFVENMEDFSNDLFSSFFD
DPVLDEKSALLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPVKMEDTTQDVEHGAWALG
NKLCSIMVKQEQSPEPPVDPLAASSAMAAAAAMVTPPLLGLSPIPRLSIPHQAPGEMTQL
PVIKAEPPEMSQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPAFSSGSMTVKEDPITADSVYAASQM
PSRSLLFYDDGASSWEDGRGALLPVEPPEGWELKPGAPVEQRPQDHLRHDRADSIHETTK
YLRETWPEDTDDNGTSPNFSHPKEWFHDRDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgcggtcttggaacctttcccggccgacaggctgttcccgggatccagcttcctg
gacttgggagacctgaatgagtcggatttcctcaacaatgcgcactttccggagcacctg
gaccactttgtggagaacatggaggacttctccaatgacctgttcagcagtttctttgat
gaccctgtgctggatgagaaaagtgctctgctggacatggaactggactcccctgctcca
ggcatccaggcggagcacagctactccctgagtggggattctgcaccccagagccctctt
gtgcctgtcaagatggaggacaccacccaagatgtggaacacggagcgtgggccctggga
aacaaactgtgctccatcatggtgaagcaggagcagagcccggagccgcctgttgatccc
ctggctgcctcctctgccatggcagctgccgccgccatggtcaccccaccactgctgggc
ctcagccccatcccccggctgtccatccctcaccaggccccgggagaaatgactcagctg
ccagtgatcaaagcagagccaccggaaatgagccagtttctcaaagtgacaccagaggac
ctcgtacagatgcctccaacaccccccagcagccatggcagcgacagtgacggatcccag
agcccccgctctcttcccccctccagccctgtccggcccatggcccgctcctccacggcc
atttccacctctccactcctcactgcccctcacaaactgcaggggacatcagggccactg
ctcttgacagaagaggagaagcggaccttgatcgccgagggttaccctatccccaccaag
ctccccctcaccaaggctgaggagaaggccttgaagagagtacgcaggaaaattaagaac
aagatctctgcccaggagagccgccgcaagaagaaggaatatgtggaatgtctagaaaag
aaggtggagacatatacatcagagaacaatgagctgtggaagaaggtcgaaaccttagag
actgccaacaggaccctgctccagcagctgcagaaactccagactctagtcaccagcaag
atctccagaccgtacaagatggcggccacgcagactggcacttgcctcatggtggcagcc
ttgtgcttcgttctggtgctgggctcccttgtgccctgccttcctgcattctcttcaggc
tccatgactgtgaaagaagaccctatcacagctgacagcgtctatgcagccagtcagatg
ccctcccgaagcctactgttctatgatgatggggcaagctcatgggaagatggccgaggt
gctctactgcctgtggagcccccagaaggctgggagctcaaacccggggctccagtagag
cagaggccccaggaccacctccgacatgaccgtgcggacagcatccacgagaccaccaag
tacttgagagagacctggccagaggacactgatgacaatggcaccagccccaacttttcc
caccccaaggagtggttccatgacagggacctgggccccaacaccaccatcaaactctcc
tag

KEGG   Mus pahari (shrew mouse): 110320678
Entry
110320678         CDS       T05929                                 
Symbol
Creb3l4
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110320678 (Creb3l4)
   04024 cAMP signaling pathway
    110320678 (Creb3l4)
   04022 cGMP-PKG signaling pathway
    110320678 (Creb3l4)
   04151 PI3K-Akt signaling pathway
    110320678 (Creb3l4)
   04152 AMPK signaling pathway
    110320678 (Creb3l4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110320678 (Creb3l4)
   04922 Glucagon signaling pathway
    110320678 (Creb3l4)
   04915 Estrogen signaling pathway
    110320678 (Creb3l4)
   04926 Relaxin signaling pathway
    110320678 (Creb3l4)
   04935 Growth hormone synthesis, secretion and action
    110320678 (Creb3l4)
   04918 Thyroid hormone synthesis
    110320678 (Creb3l4)
   04928 Parathyroid hormone synthesis, secretion and action
    110320678 (Creb3l4)
   04916 Melanogenesis
    110320678 (Creb3l4)
   04925 Aldosterone synthesis and secretion
    110320678 (Creb3l4)
   04927 Cortisol synthesis and secretion
    110320678 (Creb3l4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110320678 (Creb3l4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110320678 (Creb3l4)
  09156 Nervous system
   04725 Cholinergic synapse
    110320678 (Creb3l4)
   04728 Dopaminergic synapse
    110320678 (Creb3l4)
  09149 Aging
   04211 Longevity regulating pathway
    110320678 (Creb3l4)
  09159 Environmental adaptation
   04714 Thermogenesis
    110320678 (Creb3l4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110320678 (Creb3l4)
   05203 Viral carcinogenesis
    110320678 (Creb3l4)
  09162 Cancer: specific types
   05215 Prostate cancer
    110320678 (Creb3l4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320678 (Creb3l4)
   05161 Hepatitis B
    110320678 (Creb3l4)
   05163 Human cytomegalovirus infection
    110320678 (Creb3l4)
   05165 Human papillomavirus infection
    110320678 (Creb3l4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110320678 (Creb3l4)
   05020 Prion disease
    110320678 (Creb3l4)
  09165 Substance dependence
   05030 Cocaine addiction
    110320678 (Creb3l4)
   05031 Amphetamine addiction
    110320678 (Creb3l4)
   05034 Alcoholism
    110320678 (Creb3l4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110320678 (Creb3l4)
   04934 Cushing syndrome
    110320678 (Creb3l4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110320678 (Creb3l4)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110320678 (Creb3l4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB KASH_CCD EMP24_GP25L DUF4407 ATG16 HAUS-augmin3 HALZ SOGA ADIP
Other DBs
NCBI-GeneID: 110320678
NCBI-ProteinID: XP_021052450
Ensembl: MGP_PahariEiJ_G0026673
LinkDB
Position
4:complement(80697484..80703586)
AA seq 385 aa
MELGCPELLEPPEDIFSTGSFLELGFNSPPSKVPVTRLQGQGLQSWELSRGCGPGLQKSE
PDDFLNLFIDPNMIYCSETSPGSDSGVSEDPGSPAPQAPSSPALYEVVYDAGALQGTQQE
AGPTFGFISIQIDQWSPAFMVPDACTVSGLPSDEHRHTLPGVSTRAQAPPAAMLSCQHHL
FLTDEEKQLLGQEGVTLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYIDGLES
RVAACSEQNQRLQRKVQELERQNIFLMAQVRQLQKLTAQTSSRAAQTSTCVLILLFSLAL
IILPSFSPFQGQSEARPEDYQLRGVISRNILTHENATESLESPVLKSKLEELPEAPTTNG
STKTHLKMRVRPTGQIRGMVHADEM
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggagctcgggtgccctgagttgctggaacccccagaagatatcttctcgacgggatcc
ttcctggagctgggattcaacagtcccccgtcaaaggtcccggtgaccaggctacaagga
caggggctgcaaagctgggagctgagtaggggctgtggcccaggccttcagaagagtgaa
cctgacgatttcctgaacctctttatcgatcccaatatgatatactgctcagaaacatct
cctggtagtgacagtggggtctctgaagatcctggatcccctgccccacaggctcccagt
tcccctgccctctatgaggttgtctatgatgcaggggccctacagggaactcagcaggaa
gctgggccaaccttcggattcatctctatccagatagatcagtggagccctgcatttatg
gtccctgatgcctgcacggtcagtggactgccctccgatgagcatagacataccctgcct
ggggtcagcaccagagcccaagcacctcctgcagccatgctgtcctgccaacatcatctg
ttcctgacagatgaagaaaagcaactgctggggcaagaaggggttactctgccctctcac
ctgcccctcaccaaggcagaggagagaatactcaagaagatcaggaggaaaatccgcaac
aagcagtcagctcaggacagccggcggcggaagaaagaatacatagatgggctagagagc
agagtggcagcctgttcggaacagaatcagagactacagagaaaggtccaggagctggag
aggcagaatatcttcttgatggcgcaggtccgccagttacagaagctcactgctcagacc
tccagcagagctgcccagaccagcacctgtgttctgattcttcttttttcactggctctc
atcatcctgcccagttttagcccctttcagggtcaatcagaagctaggcctgaggattat
cagcttcgtggagtgatctccagaaatatcttgactcacgagaacgcaacagaaagcctg
gagagtccagtgctaaagtccaaactggaggagctacctgaagccccaactacaaatggt
tcaacaaagacacatctgaagatgcgagtgagacccactgggcagatcaggggaatggtg
catgcagatgagatgtaa

KEGG   Mus pahari (shrew mouse): 110322391
Entry
110322391         CDS       T05929                                 
Symbol
Creb1
Name
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04380  Osteoclast differentiation
mpah04612  Antigen processing and presentation
mpah04668  TNF signaling pathway
mpah04710  Circadian rhythm
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110322391 (Creb1)
   04024 cAMP signaling pathway
    110322391 (Creb1)
   04022 cGMP-PKG signaling pathway
    110322391 (Creb1)
   04151 PI3K-Akt signaling pathway
    110322391 (Creb1)
   04152 AMPK signaling pathway
    110322391 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110322391 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    110322391 (Creb1)
   04922 Glucagon signaling pathway
    110322391 (Creb1)
   04915 Estrogen signaling pathway
    110322391 (Creb1)
   04926 Relaxin signaling pathway
    110322391 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    110322391 (Creb1)
   04918 Thyroid hormone synthesis
    110322391 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110322391 (Creb1)
   04916 Melanogenesis
    110322391 (Creb1)
   04924 Renin secretion
    110322391 (Creb1)
   04925 Aldosterone synthesis and secretion
    110322391 (Creb1)
   04927 Cortisol synthesis and secretion
    110322391 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110322391 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110322391 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    110322391 (Creb1)
   04728 Dopaminergic synapse
    110322391 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110322391 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    110322391 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110322391 (Creb1)
   04713 Circadian entrainment
    110322391 (Creb1)
   04714 Thermogenesis
    110322391 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110322391 (Creb1)
   05203 Viral carcinogenesis
    110322391 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110322391 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322391 (Creb1)
   05161 Hepatitis B
    110322391 (Creb1)
   05163 Human cytomegalovirus infection
    110322391 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322391 (Creb1)
   05165 Human papillomavirus infection
    110322391 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110322391 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110322391 (Creb1)
   05020 Prion disease
    110322391 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    110322391 (Creb1)
   05031 Amphetamine addiction
    110322391 (Creb1)
   05034 Alcoholism
    110322391 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110322391 (Creb1)
   04934 Cushing syndrome
    110322391 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110322391 (Creb1)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110322391 (Creb1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110322391 (Creb1)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    110322391 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 110322391
NCBI-ProteinID: XP_021054709
Ensembl: MGP_PahariEiJ_G0027445
LinkDB
Position
5:43563233..43633158
AA seq 341 aa
MTMESGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagacaaccagcagagtggagacgctgctgtaacagaagct
gagagccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcacgcgacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcagcccagccatcagtgatccagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtctgtggatagtgtaactgat
tcccaaaaacgaagggaaatcctctcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggggtgccaaggatcgaagaagaaaagtcagaagaggaaact
tcagcccctgccatcaccactgtaacagtgccaacccccatttaccaaactagcagtggg
cagtacattgccattacccagggaggagcaatacagctggctaacaatggtacggatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagattctagtgcccagcaaccaagtt
gttgttcaagctgcctctggcgatgtacaaacataccagatccgcacagcacccacgagc
accattgcccctggagttgtcatggcgtcctccccagcacttcctacacagcctgccgaa
gaagcagcacgcaagagagaggttcgtctaatgaagaacagggaagcagcaagagaatgt
cgtagaaagaagaaagaatatgtgaaatgtttagagaacagagtggcagtgcttgaaaac
caaaacaaaacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Mus pahari (shrew mouse): 110326077
Entry
110326077         CDS       T05929                                 
Symbol
Creb3l3
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110326077 (Creb3l3)
   04024 cAMP signaling pathway
    110326077 (Creb3l3)
   04022 cGMP-PKG signaling pathway
    110326077 (Creb3l3)
   04151 PI3K-Akt signaling pathway
    110326077 (Creb3l3)
   04152 AMPK signaling pathway
    110326077 (Creb3l3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110326077 (Creb3l3)
   04922 Glucagon signaling pathway
    110326077 (Creb3l3)
   04915 Estrogen signaling pathway
    110326077 (Creb3l3)
   04926 Relaxin signaling pathway
    110326077 (Creb3l3)
   04935 Growth hormone synthesis, secretion and action
    110326077 (Creb3l3)
   04918 Thyroid hormone synthesis
    110326077 (Creb3l3)
   04928 Parathyroid hormone synthesis, secretion and action
    110326077 (Creb3l3)
   04916 Melanogenesis
    110326077 (Creb3l3)
   04925 Aldosterone synthesis and secretion
    110326077 (Creb3l3)
   04927 Cortisol synthesis and secretion
    110326077 (Creb3l3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110326077 (Creb3l3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110326077 (Creb3l3)
  09156 Nervous system
   04725 Cholinergic synapse
    110326077 (Creb3l3)
   04728 Dopaminergic synapse
    110326077 (Creb3l3)
  09149 Aging
   04211 Longevity regulating pathway
    110326077 (Creb3l3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110326077 (Creb3l3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110326077 (Creb3l3)
   05203 Viral carcinogenesis
    110326077 (Creb3l3)
  09162 Cancer: specific types
   05215 Prostate cancer
    110326077 (Creb3l3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110326077 (Creb3l3)
   05161 Hepatitis B
    110326077 (Creb3l3)
   05163 Human cytomegalovirus infection
    110326077 (Creb3l3)
   05165 Human papillomavirus infection
    110326077 (Creb3l3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110326077 (Creb3l3)
   05020 Prion disease
    110326077 (Creb3l3)
  09165 Substance dependence
   05030 Cocaine addiction
    110326077 (Creb3l3)
   05031 Amphetamine addiction
    110326077 (Creb3l3)
   05034 Alcoholism
    110326077 (Creb3l3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110326077 (Creb3l3)
   04934 Cushing syndrome
    110326077 (Creb3l3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110326077 (Creb3l3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110326077 (Creb3l3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ADIP
Other DBs
NCBI-GeneID: 110326077
NCBI-ProteinID: XP_021059908
Ensembl: MGP_PahariEiJ_G0031031
LinkDB
Position
9:complement(45619013..45627611)
AA seq 482 aa
MDGDVATGKMASPVCAMAPLDSMEVLDLLFDRQDGILRNVELSEGWILAREEQKVLLNSD
SDEFLNCILGPGDSDPSSPLWSPADSDSGISEDLPSDPQDTPPRSGTEPANTVARCHTRE
QGEGPCLSYLPSTPCPEPPRTQVRESSVAIDLDMWSTDTLYPEEQAGSPSRFNLTVKELL
LSGGGGDLQQHSLAASQLLGPGSGHCQELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
HLQALVLQSTSKPAHAGTCIAVLLLSFVLIILPSISPFNSNKVDSPGDFVPVRVFSRTLH
NHAASRVAPDVTPGSEVPGPWPDVGTPHKGPSSGGGLSADWGNFLEIPMLDNPTEELDNS
TLVLANSTEDLGRATLLDWVASEPLLSPGRLGLEMPGEMWLSWVPRWLRVRVVQDALGVL
TG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggatggggacgtagcgactggaaagatggcgtcccctgtctgtgctatggcgcccttg
gacagcatggaagtccttgacctcctgtttgatcggcaggatggcatcctgagaaacgtg
gagctgtccgagggctggatccttgccagagaggagcagaaagttctactaaattctgac
tctgatgaattcctaaattgcatcctgggacctggagactctgaccccagctccccatta
tggtcccccgctgacagtgacagtggcatctctgaggatctaccttcagacccccaggac
acccctcctcgtagtggcactgaaccagctaacacggtagccaggtgtcacaccagggag
caaggcgaggggccctgcctctcctatctgcccagcaccccatgccctgagcctccaagg
acacaagtccgtgagtcctcagtggccattgacctggacatgtggagcacagatactctg
tacccggaggaacaggctggctcaccctcccgcttcaacctcactgtgaaggaactgctg
ctgtccggtggcggcggggacttgcaacagcattccttggctgcctcccagctgctggga
cctgggagtgggcactgccaggagctggtgctgacagaggatgagaagaaattgctggct
aaagagggggtgaccctccccacccagctgcctctcaccaagtatgaggaacgagtgttg
aaaaaaatccgcagaaagatccggaacaaacagtcggctcaagagagcaggaagaagaaa
aaagaatacattgacggtttggagaaccgaatgtcagcatgtactgcccagaaccaggag
ctgcagaggaaggttttgcatttagaaaagcaaaatttgtctcttctggagcagctgaaa
cacttgcaggcacttgtgctccagtcaaccagcaagccagcccatgcaggcacctgcata
gcggtccttctgctgtccttcgtcctgatcatcctcccctccatcagccctttcaactcc
aacaaagtcgacagccctggagacttcgtgccagtgcgagtgttttccagaaccctccac
aaccacgctgcatcccgcgtggctcccgacgtcaccccaggatccgaggtcccaggaccc
tggcccgacgtcggtaccccccacaaaggcccttcctccggcggcggcctcagtgcagac
tggggaaattttctggaaattccaatgttggacaacccgacagaagagctagacaactcc
accctggtgctggccaactctacagaggacctgggacgggccaccctgctggactgggtg
gcttcagaaccactgctcagtccgggccggttggggctggagatgccaggggagatgtgg
ctgtcctgggtaccaaggtggcttagggtccgtgtggtgcaagatgctttgggggtgctg
acaggctaa

KEGG   Mus pahari (shrew mouse): 110338975
Entry
110338975         CDS       T05929                                 
Symbol
Creb3
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04714  Thermogenesis
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04931  Insulin resistance
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
mpah05207  Chemical carcinogenesis - receptor activation
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110338975 (Creb3)
   04024 cAMP signaling pathway
    110338975 (Creb3)
   04022 cGMP-PKG signaling pathway
    110338975 (Creb3)
   04151 PI3K-Akt signaling pathway
    110338975 (Creb3)
   04152 AMPK signaling pathway
    110338975 (Creb3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110338975 (Creb3)
   04922 Glucagon signaling pathway
    110338975 (Creb3)
   04915 Estrogen signaling pathway
    110338975 (Creb3)
   04926 Relaxin signaling pathway
    110338975 (Creb3)
   04935 Growth hormone synthesis, secretion and action
    110338975 (Creb3)
   04918 Thyroid hormone synthesis
    110338975 (Creb3)
   04928 Parathyroid hormone synthesis, secretion and action
    110338975 (Creb3)
   04916 Melanogenesis
    110338975 (Creb3)
   04925 Aldosterone synthesis and secretion
    110338975 (Creb3)
   04927 Cortisol synthesis and secretion
    110338975 (Creb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110338975 (Creb3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110338975 (Creb3)
  09156 Nervous system
   04725 Cholinergic synapse
    110338975 (Creb3)
   04728 Dopaminergic synapse
    110338975 (Creb3)
  09149 Aging
   04211 Longevity regulating pathway
    110338975 (Creb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110338975 (Creb3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    110338975 (Creb3)
   05203 Viral carcinogenesis
    110338975 (Creb3)
  09162 Cancer: specific types
   05215 Prostate cancer
    110338975 (Creb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110338975 (Creb3)
   05161 Hepatitis B
    110338975 (Creb3)
   05163 Human cytomegalovirus infection
    110338975 (Creb3)
   05165 Human papillomavirus infection
    110338975 (Creb3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110338975 (Creb3)
   05020 Prion disease
    110338975 (Creb3)
  09165 Substance dependence
   05030 Cocaine addiction
    110338975 (Creb3)
   05031 Amphetamine addiction
    110338975 (Creb3)
   05034 Alcoholism
    110338975 (Creb3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110338975 (Creb3)
   04934 Cushing syndrome
    110338975 (Creb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110338975 (Creb3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110338975 (Creb3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF6262
Other DBs
NCBI-GeneID: 110338975
NCBI-ProteinID: XP_021078104
Ensembl: MGP_PahariEiJ_G0024087
LinkDB
Position
22:48384805..48389453
AA seq 371 aa
MDPGGQDLLALDPGDQDLLGFLLEESGDLWAATEPDVEAPLDLELSPSEVGSDWEVEDLL
SSLLSPSASRDVLSSSSSSILHDHNYSLPQEHVSIDLDTESFEKEGFHMTPLHGEETAAE
QMSRLILTEEEKMLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYV
VGLESRVLKYTAQNQELQNKVQRLEEQNLSLLDQLRKLQAMVIEIANKTSSGSTCVLVLV
FSFCLLLVPTMYSSDARGSVPAEYVVLHRKLRALPSEDHHQPKPSAIEHMDSTHQSLDSS
EHTFLVSSNFSCVLYHVPQAEQPLHRPRRDLSSEMLFSDSSLLLQANLSESGGWQPNHSP
SLVILQGRYSG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggatcctggtggtcaggacctgctagctttggatcctggtgatcaggacctgctgggc
ttcctgctagaggaaagcggagatttgtgggctgcgactgagccggacgtggaggctccg
ctggacttggagctgtcaccttccgaggtgggtagcgactgggaggtagaggatttactg
agttctctgctcagcccctcagcatcgcgggatgttctcagctcttccagctcttccatt
ctccatgatcacaactactcccttccacaggagcatgtctccatagatctagacactgag
agcttcgaaaaggaggggttccacatgactccactgcatggggaggaaacagcagcagag
cagatgtctaggctgatactgacggaggaagagaagatgcttttggagaaggaggggctc
actctgccctcaacccttcctctcactaaggtggaggaacaagttctaaaacgagtacgg
aggaagattcgtaacaagagagcagctcaagaaagccgcaagaagaagaaggtgtatgta
gtggggctggagagcagggtcttgaaatacacagctcagaatcaggagctacagaacaag
gtgcagcgtctggaggaacagaatctgtcccttctagatcaactgaggaagcttcaggcc
atggtgatcgagatagccaacaaaaccagcagcggcagcacttgtgtcctggtcctcgtg
ttctccttctgtcttctcctggtacctactatgtactcttctgatgcaaggggaagtgtg
cccgcggagtatgttgtgttgcaccgcaagcttcgtgccctccccagcgaggaccatcat
cagccgaagccgtctgccatagagcacatggacagcacacaccagtcgctggatagctca
gaacatacgttcttggtctccagcaacttttcctgtgtactgtatcacgtgcctcaggcg
gagcagcccttgcaccggccacgccgtgatctttcttcagagatgctcttctcagactcc
agccttctcctgcaggcaaatctttcagaaagcgggggatggcaacctaaccacagccct
tctttggtcatcttgcagggcaggtattcaggttag

DBGET integrated database retrieval system