KEGG   Mus pahari (shrew mouse): 110316221
Entry
110316221         CDS       T05929                                 

Gene name
Kras
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316221 (Kras)
   04012 ErbB signaling pathway
    110316221 (Kras)
   04014 Ras signaling pathway
    110316221 (Kras)
   04015 Rap1 signaling pathway
    110316221 (Kras)
   04370 VEGF signaling pathway
    110316221 (Kras)
   04371 Apelin signaling pathway
    110316221 (Kras)
   04068 FoxO signaling pathway
    110316221 (Kras)
   04072 Phospholipase D signaling pathway
    110316221 (Kras)
   04071 Sphingolipid signaling pathway
    110316221 (Kras)
   04151 PI3K-Akt signaling pathway
    110316221 (Kras)
   04150 mTOR signaling pathway
    110316221 (Kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110316221 (Kras)
   04137 Mitophagy - animal
    110316221 (Kras)
  09143 Cell growth and death
   04210 Apoptosis
    110316221 (Kras)
   04218 Cellular senescence
    110316221 (Kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110316221 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110316221 (Kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110316221 (Kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110316221 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    110316221 (Kras)
   04660 T cell receptor signaling pathway
    110316221 (Kras)
   04662 B cell receptor signaling pathway
    110316221 (Kras)
   04664 Fc epsilon RI signaling pathway
    110316221 (Kras)
   04062 Chemokine signaling pathway
    110316221 (Kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110316221 (Kras)
   04929 GnRH secretion
    110316221 (Kras)
   04912 GnRH signaling pathway
    110316221 (Kras)
   04915 Estrogen signaling pathway
    110316221 (Kras)
   04914 Progesterone-mediated oocyte maturation
    110316221 (Kras)
   04917 Prolactin signaling pathway
    110316221 (Kras)
   04921 Oxytocin signaling pathway
    110316221 (Kras)
   04926 Relaxin signaling pathway
    110316221 (Kras)
   04935 Growth hormone synthesis, secretion and action
    110316221 (Kras)
   04919 Thyroid hormone signaling pathway
    110316221 (Kras)
   04916 Melanogenesis
    110316221 (Kras)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110316221 (Kras)
  09156 Nervous system
   04725 Cholinergic synapse
    110316221 (Kras)
   04726 Serotonergic synapse
    110316221 (Kras)
   04720 Long-term potentiation
    110316221 (Kras)
   04730 Long-term depression
    110316221 (Kras)
   04722 Neurotrophin signaling pathway
    110316221 (Kras)
  09158 Development and regeneration
   04360 Axon guidance
    110316221 (Kras)
  09149 Aging
   04211 Longevity regulating pathway
    110316221 (Kras)
   04213 Longevity regulating pathway - multiple species
    110316221 (Kras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110316221 (Kras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316221 (Kras)
   05206 MicroRNAs in cancer
    110316221 (Kras)
   05205 Proteoglycans in cancer
    110316221 (Kras)
   05207 Chemical carcinogenesis - receptor activation
    110316221 (Kras)
   05203 Viral carcinogenesis
    110316221 (Kras)
   05230 Central carbon metabolism in cancer
    110316221 (Kras)
   05231 Choline metabolism in cancer
    110316221 (Kras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110316221 (Kras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110316221 (Kras)
   05212 Pancreatic cancer
    110316221 (Kras)
   05225 Hepatocellular carcinoma
    110316221 (Kras)
   05226 Gastric cancer
    110316221 (Kras)
   05214 Glioma
    110316221 (Kras)
   05216 Thyroid cancer
    110316221 (Kras)
   05221 Acute myeloid leukemia
    110316221 (Kras)
   05220 Chronic myeloid leukemia
    110316221 (Kras)
   05218 Melanoma
    110316221 (Kras)
   05211 Renal cell carcinoma
    110316221 (Kras)
   05219 Bladder cancer
    110316221 (Kras)
   05215 Prostate cancer
    110316221 (Kras)
   05213 Endometrial cancer
    110316221 (Kras)
   05224 Breast cancer
    110316221 (Kras)
   05223 Non-small cell lung cancer
    110316221 (Kras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110316221 (Kras)
   05170 Human immunodeficiency virus 1 infection
    110316221 (Kras)
   05161 Hepatitis B
    110316221 (Kras)
   05160 Hepatitis C
    110316221 (Kras)
   05163 Human cytomegalovirus infection
    110316221 (Kras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110316221 (Kras)
   05165 Human papillomavirus infection
    110316221 (Kras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316221 (Kras)
   05022 Pathways of neurodegeneration - multiple diseases
    110316221 (Kras)
  09165 Substance dependence
   05034 Alcoholism
    110316221 (Kras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110316221 (Kras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110316221 (Kras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316221 (Kras)
   01522 Endocrine resistance
    110316221 (Kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110316221 (Kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110316221 (Kras)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110316221 (Kras)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110316221 (Kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha FeoB_N ATP_bind_1 CbiA
Other DBs
NCBI-GeneID: 110316221
NCBI-ProteinID: XP_021045989
Ensembl: MGP_PahariEiJ_G0022808
LinkDB
Position
2
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCVIMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSRTRCIVM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctggtagggaataagtgtgatttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttacgggattccg
ttcattgagacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcgttataatgggtgttgacgatgccttctatacattagtccga
gaaattcgaaaacataaagaaaagatgagcaaagatgggaaaaagaagaagaagaagtca
aggacaaggtgtatagttatgtga

KEGG   Mus pahari (shrew mouse): 110318967
Entry
110318967         CDS       T05929                                 

Definition
(RefSeq) GTPase HRas-like isoform X1
  KO
K02833  GTPase HRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110318967
   04012 ErbB signaling pathway
    110318967
   04014 Ras signaling pathway
    110318967
   04015 Rap1 signaling pathway
    110318967
   04370 VEGF signaling pathway
    110318967
   04371 Apelin signaling pathway
    110318967
   04630 JAK-STAT signaling pathway
    110318967
   04068 FoxO signaling pathway
    110318967
   04072 Phospholipase D signaling pathway
    110318967
   04071 Sphingolipid signaling pathway
    110318967
   04151 PI3K-Akt signaling pathway
    110318967
   04150 mTOR signaling pathway
    110318967
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110318967
   04140 Autophagy - animal
    110318967
   04137 Mitophagy - animal
    110318967
  09143 Cell growth and death
   04210 Apoptosis
    110318967
   04218 Cellular senescence
    110318967
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110318967
   04540 Gap junction
    110318967
   04550 Signaling pathways regulating pluripotency of stem cells
    110318967
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110318967
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110318967
   04650 Natural killer cell mediated cytotoxicity
    110318967
   04660 T cell receptor signaling pathway
    110318967
   04662 B cell receptor signaling pathway
    110318967
   04664 Fc epsilon RI signaling pathway
    110318967
   04062 Chemokine signaling pathway
    110318967
  09152 Endocrine system
   04910 Insulin signaling pathway
    110318967
   04929 GnRH secretion
    110318967
   04912 GnRH signaling pathway
    110318967
   04915 Estrogen signaling pathway
    110318967
   04917 Prolactin signaling pathway
    110318967
   04921 Oxytocin signaling pathway
    110318967
   04926 Relaxin signaling pathway
    110318967
   04935 Growth hormone synthesis, secretion and action
    110318967
   04919 Thyroid hormone signaling pathway
    110318967
   04916 Melanogenesis
    110318967
  09156 Nervous system
   04725 Cholinergic synapse
    110318967
   04726 Serotonergic synapse
    110318967
   04720 Long-term potentiation
    110318967
   04730 Long-term depression
    110318967
   04722 Neurotrophin signaling pathway
    110318967
  09158 Development and regeneration
   04360 Axon guidance
    110318967
  09149 Aging
   04211 Longevity regulating pathway
    110318967
   04213 Longevity regulating pathway - multiple species
    110318967
  09159 Environmental adaptation
   04714 Thermogenesis
    110318967
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318967
   05206 MicroRNAs in cancer
    110318967
   05205 Proteoglycans in cancer
    110318967
   05207 Chemical carcinogenesis - receptor activation
    110318967
   05203 Viral carcinogenesis
    110318967
   05230 Central carbon metabolism in cancer
    110318967
   05231 Choline metabolism in cancer
    110318967
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110318967
  09162 Cancer: specific types
   05210 Colorectal cancer
    110318967
   05225 Hepatocellular carcinoma
    110318967
   05226 Gastric cancer
    110318967
   05214 Glioma
    110318967
   05216 Thyroid cancer
    110318967
   05221 Acute myeloid leukemia
    110318967
   05220 Chronic myeloid leukemia
    110318967
   05218 Melanoma
    110318967
   05211 Renal cell carcinoma
    110318967
   05219 Bladder cancer
    110318967
   05215 Prostate cancer
    110318967
   05213 Endometrial cancer
    110318967
   05224 Breast cancer
    110318967
   05223 Non-small cell lung cancer
    110318967
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110318967
   05170 Human immunodeficiency virus 1 infection
    110318967
   05161 Hepatitis B
    110318967
   05160 Hepatitis C
    110318967
   05163 Human cytomegalovirus infection
    110318967
   05167 Kaposi sarcoma-associated herpesvirus infection
    110318967
   05165 Human papillomavirus infection
    110318967
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110318967
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110318967
   05022 Pathways of neurodegeneration - multiple diseases
    110318967
  09165 Substance dependence
   05034 Alcoholism
    110318967
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110318967
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110318967
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110318967
   01522 Endocrine resistance
    110318967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110318967
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110318967
   04031 GTP-binding proteins [BR:mpah04031]
    110318967
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110318967
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110318967
  Exosomal proteins of colorectal cancer cells
   110318967
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110318967
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase FeoB_N
Other DBs
NCBI-GeneID: 110318967
NCBI-ProteinID: XP_021049990
LinkDB
Position
3
AA seq 166 aa
MTEYKLVAVGAGAMGKSALTIQLIRNHFVDEHDPTIEDSYRKQVVIDGETCVLDILDTSG
QEEYSAMRDQYMHTGEGFLCVFAINNTKSFEDIHQYREQIKWVRDSDDVPTVLVDNKCDL
AAGTVEFRQAQDLAHSYGIPYIETSAKTRQGVEDAFVTLVCEIQRY
NT seq 501 nt   +upstreamnt  +downstreamnt
atgacagagtacaagcttgtggcggtgggcgctggagccatgggcaagagtgccctgacc
atccagctgatccggaaccactttgtggatgagcatgatcccaccatagaggactcctac
cgaaaacaggtggtcattgatggggagacatgtgtactggacatcttagacacatcaggt
caagaagagtatagtgccatgagggaccagtacatgcacacaggggagggcttcctctgt
gtatttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc
aagtgggtgagagattcagatgatgtgccaacggtgttggtggacaacaagtgtgacctg
gccgctggcactgttgagtttcggcaggcccaggaccttgctcacagttatggcatcccc
tacattgaaacatcagccaagactcggcaaggtgtggaggatgccttcgttacactagtc
tgtgagattcagaggtactga

KEGG   Mus pahari (shrew mouse): 110319567
Entry
110319567         CDS       T05929                                 

Gene name
Hras
Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110319567 (Hras)
   04012 ErbB signaling pathway
    110319567 (Hras)
   04014 Ras signaling pathway
    110319567 (Hras)
   04015 Rap1 signaling pathway
    110319567 (Hras)
   04370 VEGF signaling pathway
    110319567 (Hras)
   04371 Apelin signaling pathway
    110319567 (Hras)
   04630 JAK-STAT signaling pathway
    110319567 (Hras)
   04068 FoxO signaling pathway
    110319567 (Hras)
   04072 Phospholipase D signaling pathway
    110319567 (Hras)
   04071 Sphingolipid signaling pathway
    110319567 (Hras)
   04151 PI3K-Akt signaling pathway
    110319567 (Hras)
   04150 mTOR signaling pathway
    110319567 (Hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110319567 (Hras)
   04140 Autophagy - animal
    110319567 (Hras)
   04137 Mitophagy - animal
    110319567 (Hras)
  09143 Cell growth and death
   04210 Apoptosis
    110319567 (Hras)
   04218 Cellular senescence
    110319567 (Hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110319567 (Hras)
   04540 Gap junction
    110319567 (Hras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110319567 (Hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110319567 (Hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110319567 (Hras)
   04650 Natural killer cell mediated cytotoxicity
    110319567 (Hras)
   04660 T cell receptor signaling pathway
    110319567 (Hras)
   04662 B cell receptor signaling pathway
    110319567 (Hras)
   04664 Fc epsilon RI signaling pathway
    110319567 (Hras)
   04062 Chemokine signaling pathway
    110319567 (Hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110319567 (Hras)
   04929 GnRH secretion
    110319567 (Hras)
   04912 GnRH signaling pathway
    110319567 (Hras)
   04915 Estrogen signaling pathway
    110319567 (Hras)
   04917 Prolactin signaling pathway
    110319567 (Hras)
   04921 Oxytocin signaling pathway
    110319567 (Hras)
   04926 Relaxin signaling pathway
    110319567 (Hras)
   04935 Growth hormone synthesis, secretion and action
    110319567 (Hras)
   04919 Thyroid hormone signaling pathway
    110319567 (Hras)
   04916 Melanogenesis
    110319567 (Hras)
  09156 Nervous system
   04725 Cholinergic synapse
    110319567 (Hras)
   04726 Serotonergic synapse
    110319567 (Hras)
   04720 Long-term potentiation
    110319567 (Hras)
   04730 Long-term depression
    110319567 (Hras)
   04722 Neurotrophin signaling pathway
    110319567 (Hras)
  09158 Development and regeneration
   04360 Axon guidance
    110319567 (Hras)
  09149 Aging
   04211 Longevity regulating pathway
    110319567 (Hras)
   04213 Longevity regulating pathway - multiple species
    110319567 (Hras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110319567 (Hras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319567 (Hras)
   05206 MicroRNAs in cancer
    110319567 (Hras)
   05205 Proteoglycans in cancer
    110319567 (Hras)
   05207 Chemical carcinogenesis - receptor activation
    110319567 (Hras)
   05203 Viral carcinogenesis
    110319567 (Hras)
   05230 Central carbon metabolism in cancer
    110319567 (Hras)
   05231 Choline metabolism in cancer
    110319567 (Hras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110319567 (Hras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110319567 (Hras)
   05225 Hepatocellular carcinoma
    110319567 (Hras)
   05226 Gastric cancer
    110319567 (Hras)
   05214 Glioma
    110319567 (Hras)
   05216 Thyroid cancer
    110319567 (Hras)
   05221 Acute myeloid leukemia
    110319567 (Hras)
   05220 Chronic myeloid leukemia
    110319567 (Hras)
   05218 Melanoma
    110319567 (Hras)
   05211 Renal cell carcinoma
    110319567 (Hras)
   05219 Bladder cancer
    110319567 (Hras)
   05215 Prostate cancer
    110319567 (Hras)
   05213 Endometrial cancer
    110319567 (Hras)
   05224 Breast cancer
    110319567 (Hras)
   05223 Non-small cell lung cancer
    110319567 (Hras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110319567 (Hras)
   05170 Human immunodeficiency virus 1 infection
    110319567 (Hras)
   05161 Hepatitis B
    110319567 (Hras)
   05160 Hepatitis C
    110319567 (Hras)
   05163 Human cytomegalovirus infection
    110319567 (Hras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110319567 (Hras)
   05165 Human papillomavirus infection
    110319567 (Hras)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319567 (Hras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110319567 (Hras)
   05022 Pathways of neurodegeneration - multiple diseases
    110319567 (Hras)
  09165 Substance dependence
   05034 Alcoholism
    110319567 (Hras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110319567 (Hras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319567 (Hras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110319567 (Hras)
   01522 Endocrine resistance
    110319567 (Hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110319567 (Hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110319567 (Hras)
   04031 GTP-binding proteins [BR:mpah04031]
    110319567 (Hras)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110319567 (Hras)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110319567 (Hras)
  Exosomal proteins of colorectal cancer cells
   110319567 (Hras)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110319567 (Hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA G-alpha ATP_bind_1 Septin Ldh_1_N Aldo_ket_red ParA AAA_16
Other DBs
NCBI-GeneID: 110319567
NCBI-ProteinID: XP_021050707
Ensembl: MGP_PahariEiJ_G0013880
LinkDB
Position
1
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
ATRTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
CMSCKCVLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaagcttgtggtggtgggcgctggaggcgtgggcaagagtgccctgacc
atccagctgatccagaaccactttgtggacgagtatgatcccaccatagaggactcctac
cggaaacaggtggtcattgatggggagacatgtctactggacatcttagacacagcaggt
caagaagaatatagcgccatgcgggaccagtacatgcgcacaggggagggcttcctctgt
gtatttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc
aagcgggtgaaagattcagatgatgtgccaatggtgctggtgggcaacaagtgtgacctg
gccactcgcactgttgagtctcggcaggcccaggaccttgctcgcagctatggcatcccc
tacattgaaacatcagccaagacccggcagggtgtggaggatgccttctatacgctagtc
cgtgagattcggcagcataaactgcggaaactgaacccgcctgatgagagtggtcctggc
tgcatgagctgcaagtgtgtgttgtcctga

KEGG   Mus pahari (shrew mouse): 110320340
Entry
110320340         CDS       T05929                                 

Gene name
Nras
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110320340 (Nras)
   04012 ErbB signaling pathway
    110320340 (Nras)
   04014 Ras signaling pathway
    110320340 (Nras)
   04015 Rap1 signaling pathway
    110320340 (Nras)
   04370 VEGF signaling pathway
    110320340 (Nras)
   04371 Apelin signaling pathway
    110320340 (Nras)
   04068 FoxO signaling pathway
    110320340 (Nras)
   04072 Phospholipase D signaling pathway
    110320340 (Nras)
   04071 Sphingolipid signaling pathway
    110320340 (Nras)
   04151 PI3K-Akt signaling pathway
    110320340 (Nras)
   04150 mTOR signaling pathway
    110320340 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110320340 (Nras)
   04137 Mitophagy - animal
    110320340 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    110320340 (Nras)
   04218 Cellular senescence
    110320340 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110320340 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110320340 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110320340 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110320340 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    110320340 (Nras)
   04660 T cell receptor signaling pathway
    110320340 (Nras)
   04662 B cell receptor signaling pathway
    110320340 (Nras)
   04664 Fc epsilon RI signaling pathway
    110320340 (Nras)
   04062 Chemokine signaling pathway
    110320340 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110320340 (Nras)
   04929 GnRH secretion
    110320340 (Nras)
   04912 GnRH signaling pathway
    110320340 (Nras)
   04915 Estrogen signaling pathway
    110320340 (Nras)
   04917 Prolactin signaling pathway
    110320340 (Nras)
   04921 Oxytocin signaling pathway
    110320340 (Nras)
   04926 Relaxin signaling pathway
    110320340 (Nras)
   04935 Growth hormone synthesis, secretion and action
    110320340 (Nras)
   04919 Thyroid hormone signaling pathway
    110320340 (Nras)
   04916 Melanogenesis
    110320340 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    110320340 (Nras)
   04726 Serotonergic synapse
    110320340 (Nras)
   04720 Long-term potentiation
    110320340 (Nras)
   04730 Long-term depression
    110320340 (Nras)
   04722 Neurotrophin signaling pathway
    110320340 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    110320340 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    110320340 (Nras)
   04213 Longevity regulating pathway - multiple species
    110320340 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110320340 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320340 (Nras)
   05206 MicroRNAs in cancer
    110320340 (Nras)
   05205 Proteoglycans in cancer
    110320340 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    110320340 (Nras)
   05203 Viral carcinogenesis
    110320340 (Nras)
   05230 Central carbon metabolism in cancer
    110320340 (Nras)
   05231 Choline metabolism in cancer
    110320340 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110320340 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110320340 (Nras)
   05225 Hepatocellular carcinoma
    110320340 (Nras)
   05226 Gastric cancer
    110320340 (Nras)
   05214 Glioma
    110320340 (Nras)
   05216 Thyroid cancer
    110320340 (Nras)
   05221 Acute myeloid leukemia
    110320340 (Nras)
   05220 Chronic myeloid leukemia
    110320340 (Nras)
   05218 Melanoma
    110320340 (Nras)
   05211 Renal cell carcinoma
    110320340 (Nras)
   05219 Bladder cancer
    110320340 (Nras)
   05215 Prostate cancer
    110320340 (Nras)
   05213 Endometrial cancer
    110320340 (Nras)
   05224 Breast cancer
    110320340 (Nras)
   05223 Non-small cell lung cancer
    110320340 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320340 (Nras)
   05170 Human immunodeficiency virus 1 infection
    110320340 (Nras)
   05161 Hepatitis B
    110320340 (Nras)
   05160 Hepatitis C
    110320340 (Nras)
   05163 Human cytomegalovirus infection
    110320340 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110320340 (Nras)
   05165 Human papillomavirus infection
    110320340 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110320340 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    110320340 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    110320340 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110320340 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110320340 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320340 (Nras)
   01522 Endocrine resistance
    110320340 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110320340 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320340 (Nras)
   04031 GTP-binding proteins [BR:mpah04031]
    110320340 (Nras)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110320340 (Nras)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110320340 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   110320340 (Nras)
  Exosomal proteins of breast cancer cells
   110320340 (Nras)
  Exosomal proteins of colorectal cancer cells
   110320340 (Nras)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110320340 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 110320340
NCBI-ProteinID: XP_021051952
Ensembl: MGP_PahariEiJ_G0026889
LinkDB
Position
4
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVLM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgacg
atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtgattgatggtgagacctgtctgttggacatactggacacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtgtttgccatcaataatagcaaatcgtttgcagatattaacctctacagggagcaaatt
aagcgtgtgaaagattctgatgatgtacccatggtgctggtagggaacaagtgtgacttg
ccaacaaggacagttgacacaaagcaagcccacgagctggccaagagttacggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaggatgccttttacacactggta
agggagatacgccagtaccgaatgaaaaagctcaacagcagtgatgatggcactcagggt
tgtatggggctgccctgtgtgctgatgtag

KEGG   Mus pahari (shrew mouse): 110333346
Entry
110333346         CDS       T05929                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333346
   04012 ErbB signaling pathway
    110333346
   04014 Ras signaling pathway
    110333346
   04015 Rap1 signaling pathway
    110333346
   04370 VEGF signaling pathway
    110333346
   04371 Apelin signaling pathway
    110333346
   04630 JAK-STAT signaling pathway
    110333346
   04068 FoxO signaling pathway
    110333346
   04072 Phospholipase D signaling pathway
    110333346
   04071 Sphingolipid signaling pathway
    110333346
   04151 PI3K-Akt signaling pathway
    110333346
   04150 mTOR signaling pathway
    110333346
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110333346
   04140 Autophagy - animal
    110333346
   04137 Mitophagy - animal
    110333346
  09143 Cell growth and death
   04210 Apoptosis
    110333346
   04218 Cellular senescence
    110333346
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110333346
   04540 Gap junction
    110333346
   04550 Signaling pathways regulating pluripotency of stem cells
    110333346
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333346
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110333346
   04650 Natural killer cell mediated cytotoxicity
    110333346
   04660 T cell receptor signaling pathway
    110333346
   04662 B cell receptor signaling pathway
    110333346
   04664 Fc epsilon RI signaling pathway
    110333346
   04062 Chemokine signaling pathway
    110333346
  09152 Endocrine system
   04910 Insulin signaling pathway
    110333346
   04929 GnRH secretion
    110333346
   04912 GnRH signaling pathway
    110333346
   04915 Estrogen signaling pathway
    110333346
   04917 Prolactin signaling pathway
    110333346
   04921 Oxytocin signaling pathway
    110333346
   04926 Relaxin signaling pathway
    110333346
   04935 Growth hormone synthesis, secretion and action
    110333346
   04919 Thyroid hormone signaling pathway
    110333346
   04916 Melanogenesis
    110333346
  09156 Nervous system
   04725 Cholinergic synapse
    110333346
   04726 Serotonergic synapse
    110333346
   04720 Long-term potentiation
    110333346
   04730 Long-term depression
    110333346
   04722 Neurotrophin signaling pathway
    110333346
  09158 Development and regeneration
   04360 Axon guidance
    110333346
  09149 Aging
   04211 Longevity regulating pathway
    110333346
   04213 Longevity regulating pathway - multiple species
    110333346
  09159 Environmental adaptation
   04714 Thermogenesis
    110333346
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333346
   05206 MicroRNAs in cancer
    110333346
   05205 Proteoglycans in cancer
    110333346
   05207 Chemical carcinogenesis - receptor activation
    110333346
   05203 Viral carcinogenesis
    110333346
   05230 Central carbon metabolism in cancer
    110333346
   05231 Choline metabolism in cancer
    110333346
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110333346
  09162 Cancer: specific types
   05210 Colorectal cancer
    110333346
   05225 Hepatocellular carcinoma
    110333346
   05226 Gastric cancer
    110333346
   05214 Glioma
    110333346
   05216 Thyroid cancer
    110333346
   05221 Acute myeloid leukemia
    110333346
   05220 Chronic myeloid leukemia
    110333346
   05218 Melanoma
    110333346
   05211 Renal cell carcinoma
    110333346
   05219 Bladder cancer
    110333346
   05215 Prostate cancer
    110333346
   05213 Endometrial cancer
    110333346
   05224 Breast cancer
    110333346
   05223 Non-small cell lung cancer
    110333346
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110333346
   05170 Human immunodeficiency virus 1 infection
    110333346
   05161 Hepatitis B
    110333346
   05160 Hepatitis C
    110333346
   05163 Human cytomegalovirus infection
    110333346
   05167 Kaposi sarcoma-associated herpesvirus infection
    110333346
   05165 Human papillomavirus infection
    110333346
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110333346
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110333346
   05022 Pathways of neurodegeneration - multiple diseases
    110333346
  09165 Substance dependence
   05034 Alcoholism
    110333346
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110333346
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110333346
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110333346
   01522 Endocrine resistance
    110333346
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110333346
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110333346
   04031 GTP-binding proteins [BR:mpah04031]
    110333346
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110333346
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110333346
  Exosomal proteins of colorectal cancer cells
   110333346
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110333346
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N PglD_N CbiA ATP_bind_1 AAA_25 NB-ARC TniB CspB_prodomain Ribosomal_L25p
Other DBs
NCBI-GeneID: 110333346
NCBI-ProteinID: XP_021070598
LinkDB
Position
15
AA seq 189 aa
MTEYKLVVVGAGGVGKSVLTIQLIQNHFVGEYDPTIEDSYGKKVVIDGETCLLDILDTTG
QEEYSTMRDQYMCTGEGFLCIFSTNNTKSFEDIHQYREQIKRVKNSNDVPMVLVGNKYDL
AACTVESQQAQDLARSYGISYIETSVKTRQGVEDTFYTLVHEIRQQKLWRVNLPDESGPG
CMSCNCVLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaagcttgtggtggtgggcgctggaggcgtgggcaagagtgtcctgacc
atccagctgatccaaaaccactttgtgggcgagtatgatcccactatagaggactcctat
ggaaaaaaggtggtcattgatggggagacatgtctactggacatcttagacacaacaggt
caagaagagtatagcaccatgcgggaccagtacatgtgcacaggggagggcttcctctgt
atattttccaccaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc
aagcgggtgaaaaattcaaatgatgtgccaatggtgttggtgggcaacaagtatgacctg
gccgcttgcactgttgagtctcagcaggcccaggaccttgctcgtagctatggcatctcc
tacattgaaacatcagtcaagactcggcagggtgtggaggataccttctatacactagtc
catgagattcggcagcaaaaactttggagagtgaacctgcctgatgagagtggtcctggc
tgcatgagctgcaattgtgtgctgtcctga

KEGG   Mus pahari (shrew mouse): 110338480
Entry
110338480         CDS       T05929                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04144  Endocytosis
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110338480
   04012 ErbB signaling pathway
    110338480
   04014 Ras signaling pathway
    110338480
   04015 Rap1 signaling pathway
    110338480
   04370 VEGF signaling pathway
    110338480
   04371 Apelin signaling pathway
    110338480
   04630 JAK-STAT signaling pathway
    110338480
   04068 FoxO signaling pathway
    110338480
   04072 Phospholipase D signaling pathway
    110338480
   04071 Sphingolipid signaling pathway
    110338480
   04151 PI3K-Akt signaling pathway
    110338480
   04150 mTOR signaling pathway
    110338480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110338480
   04140 Autophagy - animal
    110338480
   04137 Mitophagy - animal
    110338480
  09143 Cell growth and death
   04210 Apoptosis
    110338480
   04218 Cellular senescence
    110338480
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110338480
   04540 Gap junction
    110338480
   04550 Signaling pathways regulating pluripotency of stem cells
    110338480
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110338480
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110338480
   04650 Natural killer cell mediated cytotoxicity
    110338480
   04660 T cell receptor signaling pathway
    110338480
   04662 B cell receptor signaling pathway
    110338480
   04664 Fc epsilon RI signaling pathway
    110338480
   04062 Chemokine signaling pathway
    110338480
  09152 Endocrine system
   04910 Insulin signaling pathway
    110338480
   04929 GnRH secretion
    110338480
   04912 GnRH signaling pathway
    110338480
   04915 Estrogen signaling pathway
    110338480
   04917 Prolactin signaling pathway
    110338480
   04921 Oxytocin signaling pathway
    110338480
   04926 Relaxin signaling pathway
    110338480
   04935 Growth hormone synthesis, secretion and action
    110338480
   04919 Thyroid hormone signaling pathway
    110338480
   04916 Melanogenesis
    110338480
  09156 Nervous system
   04725 Cholinergic synapse
    110338480
   04726 Serotonergic synapse
    110338480
   04720 Long-term potentiation
    110338480
   04730 Long-term depression
    110338480
   04722 Neurotrophin signaling pathway
    110338480
  09158 Development and regeneration
   04360 Axon guidance
    110338480
  09149 Aging
   04211 Longevity regulating pathway
    110338480
   04213 Longevity regulating pathway - multiple species
    110338480
  09159 Environmental adaptation
   04714 Thermogenesis
    110338480
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338480
   05206 MicroRNAs in cancer
    110338480
   05205 Proteoglycans in cancer
    110338480
   05207 Chemical carcinogenesis - receptor activation
    110338480
   05203 Viral carcinogenesis
    110338480
   05230 Central carbon metabolism in cancer
    110338480
   05231 Choline metabolism in cancer
    110338480
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110338480
  09162 Cancer: specific types
   05210 Colorectal cancer
    110338480
   05225 Hepatocellular carcinoma
    110338480
   05226 Gastric cancer
    110338480
   05214 Glioma
    110338480
   05216 Thyroid cancer
    110338480
   05221 Acute myeloid leukemia
    110338480
   05220 Chronic myeloid leukemia
    110338480
   05218 Melanoma
    110338480
   05211 Renal cell carcinoma
    110338480
   05219 Bladder cancer
    110338480
   05215 Prostate cancer
    110338480
   05213 Endometrial cancer
    110338480
   05224 Breast cancer
    110338480
   05223 Non-small cell lung cancer
    110338480
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110338480
   05170 Human immunodeficiency virus 1 infection
    110338480
   05161 Hepatitis B
    110338480
   05160 Hepatitis C
    110338480
   05163 Human cytomegalovirus infection
    110338480
   05167 Kaposi sarcoma-associated herpesvirus infection
    110338480
   05165 Human papillomavirus infection
    110338480
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110338480
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110338480
   05022 Pathways of neurodegeneration - multiple diseases
    110338480
  09165 Substance dependence
   05034 Alcoholism
    110338480
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110338480
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110338480
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110338480
   01522 Endocrine resistance
    110338480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110338480
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110338480
   04031 GTP-binding proteins [BR:mpah04031]
    110338480
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110338480
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110338480
  Exosomal proteins of colorectal cancer cells
   110338480
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110338480
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase ATP_bind_1 MMR_HSR1 FeoB_N Septin
Other DBs
NCBI-GeneID: 110338480
NCBI-ProteinID: XP_021077476
LinkDB
Position
21
AA seq 189 aa
MTEYQLVVVGAGGLGKSALTIQLIQNYFVDEYDPTIADSYRKQVVIDGETCLLDILDTTG
QEEYSAMWDQYMQTGEGFLCIFAINNTKSFEDIHQYREQIKQVKNSDDLPMVLVGNKCDL
AARTVEPRQTQDLSHSYGIPYIETTAKTRQGVEDAFYMLVREILQQKLQRLNLPHDSGPD
CMSCKCVLF
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaataccagcttgtggttgtgggtgctggaggcctgggcaagagtgccctgacc
atccagctgatccaaaactactttgtggatgaatatgatcccactatagcggactcctac
cgaaaacaggtggtcattgatggggagacatgtctactggacatcttagacacaacaggt
caagaagagtatagtgccatgtgggaccagtacatgcaaacaggggagggcttcctctgt
atatttgccatcaacaacaccaagtcctttgaagacatccatcagtacagggagcagatc
aagcaggtaaaaaattcagatgatttgccaatggtgctggtgggcaacaagtgtgacctg
gccgctcgcactgttgagcctcggcagacccaggacctttctcacagctatggcatcccc
tacattgaaacaacagccaagactcggcaaggtgtggaggatgccttctatatgctagtc
cgtgagattctgcagcaaaaactacagagactgaacctgcctcatgacagtggtcctgac
tgcatgagctgcaagtgtgtgctgttctga

DBGET integrated database retrieval system