KEGG   Mus pahari (shrew mouse): 110316251
Entry
110316251         CDS       T05929                                 

Gene name
Cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04141  Protein processing in endoplasmic reticulum
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04710  Circadian rhythm
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110316251 (Cul1)
   04120 Ubiquitin mediated proteolysis
    110316251 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316251 (Cul1)
   04340 Hedgehog signaling pathway
    110316251 (Cul1)
   04350 TGF-beta signaling pathway
    110316251 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110316251 (Cul1)
   04114 Oocyte meiosis
    110316251 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110316251 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316251 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110316251 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110316251 (Cul1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     110316251 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 DUF4980
Other DBs
NCBI-GeneID: 110316251
NCBI-ProteinID: XP_021046050
Ensembl: MGP_PahariEiJ_G0022081
LinkDB
Position
2
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagattggtcttgaccagatc
tgggatgacctcagagctggaattcagcaagtgtataccagacaaagcatggcaaagtcc
agatacatggaactctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgttggcttggagttatacaagcgattgaaggagtttttgaagaactatttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtactgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgccgtgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaagttgattgaaaaggaaagaaatggagaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtttgcttgaggaacagcggagagttcaggtttacctccat
gagagcacacaagatgaactagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttattggatgctgacaagaatgaagatttgggc
cgtatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcagcaattgagaagtgtggagaagctgctcta
aatgaccccaagatgtatgtgcagacagtgttggatgttcataaaaaatacaatgccctg
gtgatgtcagcgttcaacaacgatgctggcttcgtcgctgctcttgataaggcttgtggt
cgcttcataaacaacaatgcggttaccaaaatggcccagtcatccagtaaatcccctgag
ctgcttgctcggtactgtgactccttgttgaagaaaagttccaagaacccagaagaggca
gaactagaagacaccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcaaaacagtgca
agtgacgatgctgaagcaagcatgatctccaagttaaagcaagcttgtggttttgagtac
acttccaaacttcagcgaatgtttcaagacattggtgtaagcaaagatctgaatgaacag
ttcaaaaaacacctgacgaattcagaaccgctggacttggacttcagtattcaggtcctg
agttctggatcgtggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttatcagcgatttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacatttcagatggcaatcctgcttcagtacaacacagaagacgcctac
actgtgcagcagctgactgacagcacgcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcgaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaaccacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtaagaatcatgaaa
atgaggaaggtcctgaaacaccagcaattacttggtgaagtcctcactcagctgtcctcc
aggttcaaacctcgggtcccagtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

KEGG   Mus pahari (shrew mouse): 110331774
Entry
110331774         CDS       T05929                                 

Gene name
Skp1
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04141  Protein processing in endoplasmic reticulum
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04710  Circadian rhythm
mpah05132  Salmonella infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110331774 (Skp1)
   04120 Ubiquitin mediated proteolysis
    110331774 (Skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331774 (Skp1)
   04350 TGF-beta signaling pathway
    110331774 (Skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110331774 (Skp1)
   04114 Oocyte meiosis
    110331774 (Skp1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110331774 (Skp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331774 (Skp1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110331774 (Skp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110331774 (Skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110331774 (Skp1)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110331774 (Skp1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     110331774 (Skp1)
   Cul7 complex
     110331774 (Skp1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     110331774 (Skp1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110331774 (Skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 110331774
NCBI-ProteinID: XP_021068302
Ensembl: MGP_PahariEiJ_G0017459
LinkDB
Position
14
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcctacgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacagtctgtgactatcaagaccatgctggaagatttgggaatggatgatgaagga
gacgatgatcctgttcctttaccaaatgttaatgcagcaattctaaaaaaggtcattcag
tggtgcacccaccacaaagatgaccctcctcctcctgaggatgatgaaaacaaagaaaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacatgc
aagactgtggccaatatgattaaggggaaaactcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaggaggcccaggtacgcaaagagaaccaatggtgt
gaagagaagtga

KEGG   Mus pahari (shrew mouse): 110334961
Entry
110334961         CDS       T05929                                 

Gene name
Rbx1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03420  Nucleotide excision repair
mpah04066  HIF-1 signaling pathway
mpah04110  Cell cycle
mpah04114  Oocyte meiosis
mpah04120  Ubiquitin mediated proteolysis
mpah04141  Protein processing in endoplasmic reticulum
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04710  Circadian rhythm
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110334961 (Rbx1)
   04120 Ubiquitin mediated proteolysis
    110334961 (Rbx1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    110334961 (Rbx1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110334961 (Rbx1)
   04350 TGF-beta signaling pathway
    110334961 (Rbx1)
   04066 HIF-1 signaling pathway
    110334961 (Rbx1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110334961 (Rbx1)
   04114 Oocyte meiosis
    110334961 (Rbx1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110334961 (Rbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334961 (Rbx1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110334961 (Rbx1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110334961 (Rbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110334961 (Rbx1)
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110334961 (Rbx1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     110334961 (Rbx1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110334961 (Rbx1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     110334961 (Rbx1)
   ECV complex
     110334961 (Rbx1)
   Cul3 complex
     110334961 (Rbx1)
   Cul4 complex
     110334961 (Rbx1)
   Cul7 complex
     110334961 (Rbx1)
   Cul9 complex
     110334961 (Rbx1)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      110334961 (Rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      110334961 (Rbx1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Other DBs
NCBI-GeneID: 110334961
NCBI-ProteinID: XP_021072686
Ensembl: MGP_PahariEiJ_G0020055
LinkDB
Position
17
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcggcgatggatgtggatacccccagcggcaccaacagcggcgcgggcaagaag
cgctttgaagttaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctctgtatcgaatgtcaggccaaccag
gcttcagctacttccgaagagtgtacggttgcttggggagtctgcaaccatgcttttcat
ttccactgcatctctcgatggctcaaaacgaggcaggtgtgtccgttggacaacagagag
tgggagttccaaaagtatgggcattaa

DBGET integrated database retrieval system