KEGG   Mus pahari (shrew mouse): 110316267
Entry
110316267         CDS       T05929                                 

Gene name
Ctnna2
Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04670  Leukocyte transendothelial migration
mpah05100  Bacterial invasion of epithelial cells
mpah05200  Pathways in cancer
mpah05213  Endometrial cancer
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110316267 (Ctnna2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110316267 (Ctnna2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110316267 (Ctnna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316267 (Ctnna2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110316267 (Ctnna2)
   05213 Endometrial cancer
    110316267 (Ctnna2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110316267 (Ctnna2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110316267 (Ctnna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110316267 (Ctnna2)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110316267 (Ctnna2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 110316267
NCBI-ProteinID: XP_021046084
Ensembl: MGP_PahariEiJ_G0022252
LinkDB
Position
2
AA seq 966 aa
MTDIHSSYTYTGSMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPS
GKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIAS
SEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNAT
NEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAF
LRHPDVAATRANRDYVFKQVQEAIAGISSAAQATSPTDEAKGHTGIGELAAALNEFDNKI
ILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLS
EYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAK
SGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAAL
TLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIA
LQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAE
QVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDY
DVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDS
GNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCP
DSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDV
IDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVAS
TKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEF
KAMDSF
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgacagatattcactcaagctacacatatacagggagtatgacttcagccacttcacct
atcattttaaaatgggatcccaaaagtttggaaatccggacactcacagtggaaagactg
ttggagccacttgtgacacaggtgacaacacttgtcaacacaagcaacaaaggtccatct
ggaaaaaagaaagggaggtcaaagaaagcccatgtgctggcagcatctgtagaacaagct
actcagaacttcctggaaaagggtgaacagattgccaaggagagtcaagacctcaaagaa
gagttggtggctgctgtagaggatgtgcggaagcaaggggagacaatgcggatcgcctcc
tcagagtttgctgatgacccttgctcttcggtcaagcgtggcaccatggtgcgtgcagca
cgggctctactgtcggctgtgacacgcttgctcatcctggccgacatggcagatgtcatg
aggcttttatcgcatctgaaaattgtcgaggaggccttggaagcagtcaaaaatgctaca
aatgaacaagaccttgcaaaccgctttaaagagtttgggaaagagatggtgaaactgaac
tatgtagctgcaagacggcagcaggagctgaaggaccctcattgtagggatgagatggct
gcagcccgtggagccctgaagaagaatgccaccatgctgtacacagcctcccaagccttc
ctccggcatccagatgttgctgctacaagagccaaccgagattatgtattcaaacaagtc
caagaggccatagctggcatctccagtgctgctcaggccacctcccccaccgatgaagcc
aaaggccacacaggcatcggagagctggctgcagccctgaatgagtttgataataagatc
atcctggaccccatgacgttcagcgaggccaggttccggccgtccctggaagagagactg
gagagcatcatcagtggggctgccctcatggcggattcctcctgcacacgtgacgaccgc
cgtgagcgtattgtggctgaatgcaatgcagttcgccaggcactccaggacctgctaagc
gagtacatgaataacactggaaggaaagaaaaaggagaccctctcaacattgcgattgac
aagatgaccaagaaaacaagagatctgaggagacagcttcggaaagctgtgatggatcac
atatcagattcgttcttggaaaccaatgtccctttgctggttctcattgaggctgcgaag
agtgggaatgagaaggaggtgaaggaatatgcccaagttttccgtgaacatgccaacaag
ctggtagaggttgccaatttggcttgttccatctccaacaatgaggaaggggtgaaatta
gtcaggatggcagccacccagattgacagcctgtgtccccaggtcattaatgctgccctc
acactggctgctaggccacaaagtaaagttgctcaggacaacatggatgtcttcaaagac
cagtgggaaaagcaggttcgagtgctcactgaagctgtggatgacatcacctctgtggat
gacttcctttctgtctcagaaaaccatatcttggaggatgtgaacaaatgtgtgattgcc
ctgcaagagggagacgtggacacactggatcgtacagctggggccatacggggccgggca
gcccgggtcattcacatcatcaatgcagaaatggagaactatgaagctggggtctatacg
gagaaagtgctggaagccacaaaattgctttcagaaacagtgatgccacgctttgccgaa
caagttgaggttgccatcgaagccctgagtgccaacgtccctcagcccttcgaggagaat
gagttcattgatgcctcgcgccttgtgtatgatggtgttcgggacatcagaaaggctgtg
ctgatgatcaggactccagaagagctagaagatgattctgactttgagcaagaggattat
gatgtgcggagtcggacaagtgttcagacagaagacgaccagctcattgctggacagagt
gcacgggctatcatggcgcaactaccacaggaggagaaagcaaaaatagctgagcaggtg
gagatcttccaccaagaaaaaagcaagctggatgctgaagtggccaagtgggacgacagt
ggcaatgacatcattgtgctggccaagcagatgtgtatgatcatgatggagatgacagac
ttcacaagaggcaaaggcccactgaaaaatacatctgatgtcattaatgctgccaagaag
attgcagaagcaggctctcgaatggacaaattagcgcgcgctgtggctgatcagtgtcct
gattcagcatgtaagcaggatttactagcctaccttcagcggattgccttgtactgccat
cagcttaacatctgcagcaaagtgaaggccgaggttcagaacctaggaggagagctcatt
gtgtcagggacaggagttcagagcactttcactaccttttatgaggtagattgtgatgtc
atagatgggggcagggctagtcaactttctacccacctcccaacctgtgctgagggagct
ccaatcgggagtggaagcagtgactcctccatgctggacagtgctacatcgctcatccag
gcagccaaaaacctgatgaatgctgttgtcctcactgtgaaagcctcttatgttgcctca
actaaataccagaaggtctatggaacagcagcggtcaactctcccgttgtatcttggaag
atgaaggctcctgaaaagaagccccttgtgaagagagaaaagcctgaagaattccagacc
cgagttcgacgggggtctcaaaagaaacacatttcacctgtgcaggctttaagtgaattc
aaggcaatggattccttctag

KEGG   Mus pahari (shrew mouse): 110326998
Entry
110326998         CDS       T05929                                 

Gene name
Ctnna3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04670  Leukocyte transendothelial migration
mpah05100  Bacterial invasion of epithelial cells
mpah05200  Pathways in cancer
mpah05213  Endometrial cancer
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110326998 (Ctnna3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110326998 (Ctnna3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110326998 (Ctnna3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326998 (Ctnna3)
  09162 Cancer: specific types
   05226 Gastric cancer
    110326998 (Ctnna3)
   05213 Endometrial cancer
    110326998 (Ctnna3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110326998 (Ctnna3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110326998 (Ctnna3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110326998 (Ctnna3)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110326998 (Ctnna3)
SSDB
Motif
Pfam: Vinculin TMEM89
Other DBs
NCBI-GeneID: 110326998
NCBI-ProteinID: XP_021061338
Ensembl: MGP_PahariEiJ_G0030819
LinkDB
Position
9
AA seq 895 aa
MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLA
SVEEATWNLLDKGEAIAKEATVLKEELAAALQEVRKESKALKTSAERFTDDPCYLPKREA
VVQAARALLAAVTRLLVLADMIDVMCLLQHVSSFQRTFESLKNVSNKSDLQRAYQKLGKE
LESLDYLAFKRQQDLKSPSQRDEIAGARAALKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALDVISNASQGIQNGPTSPEPQAATLGSALEELENLIVLNPLTVTEEDVRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMSNTGKTESSNTLT
AAIVNMSKKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAGIFHE
HTGRLVEVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTME
MYKRTWEHYIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLTA
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEDDHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSAG
PRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcggcagaaacaccaataaccctgaatatggacactcaggacctgcagatccagacg
ttcactgtggagaaactgctggagcctctgataatccaggttactaccctggtgaattgt
ccacagaatccttccaacaggaagaaaggacgttcaaagagagccagagttcttctagca
tctgtggaggaagccacttggaatttgttagacaagggggaggcgatcgctaaggaagcc
acggttttaaaggaagagctggcagctgcactgcaggaagttcggaaagagagcaaagct
ctgaagacatcagctgagagatttacagacgacccttgttacctcccgaaaagggaggcc
gtggttcaagccgcccgcgccctgttggcagcagttacaagactcctcgttcttgcggac
atgatcgatgtcatgtgcctcttgcagcatgtgtcatctttccaaagaacattcgagtct
ctcaaaaatgtttccaacaaatctgacctccagagagcctaccagaagctggggaaggag
ctggaaagcctggattatttggccttcaaacgccagcaggacttaaaatctccaagccag
agggatgaaatcgcgggggcccgggctgccttgaaggagaactccccactcctgcattcg
atttgttcagcgtgtttggaacattccgatgtcgcttcgctcaaagccagtaaggacacc
gtctgtgaagagatccagaacgctcttgatgtaatttcaaatgcttcccaaggcatccag
aatgggccaacgtcccctgaaccccaggcagcaacactgggaagtgctcttgaggagctg
gagaacctaattgtcctgaacccactcacagtgacagaggaagacgtaagaccatcacta
gaaaaacgcctagaagccatcatcagtggggccgcactgttggctgactcgtcctgcacc
agggacctccaccgggagcggatcatcgccgagtgcaatgccatccgccaggctctccag
gacctgctgtcggagtacatgagtaatactgggaaaacagaaagcagtaataccctgact
gctgccattgtcaacatgagcaagaagacaagagacctccgcagacagctccgcaaggct
attatagatcacatatcagattctttcttggatacaacagttccactcctggtcctcatt
gaagctgcgaagaatggccgagtcaaggaaatcaaagactatgctggcatatttcacgag
cacaccggtaggcttgtggaggtggcaaatctggcttgttccatgtcaacgaatgaagat
gggattaaaatcgtcagaattgcagccaatcacctggagaccctgtgtccacagatcata
aatgctgcacttgctttggcatcaagacccaagagtcaagtggtcaaaaacaccatggaa
atgtacaagcgcacatgggaacactacatccatgtcctcactgaagctgtagatgacatc
accagcattgacgacttcctggctgtatctgaaagccacatcctggaagatgtcaacaaa
tgcattatagccttgagagaccaggatgctgataatttagaccgagctgccggtgccatc
agaggacgggccgcaagagtagctcacatcgttgcgggtgaaatggatagttacgagcct
ggcgcttacactgaaggtgtgatgagaaatgtcaacttccttacaagcactgtgatcccg
gagttcgtgacacaagtgaatgtggccctggaggctttaagcaagaactccctgactgct
cttgatgataatcagtttgtggacatctcaaagaagatctatgacacaatccatgatatc
aggtgttcggtcatgatgatccggacaccagaggaactagaggatgtttctgaccttgaa
gacgaccatgaggtccgtagccacaccagcattcagacagaagggaaaactgatcgggcc
aagatgactcaactgcctgaggcagaaaaggaaaagattgccgagcaagtcgccgacttc
aagaaggtgaagagcaagctggacgctgagattgagatatgggacgacacaagcaatgac
atcatcgtcctcgccaagaagatgtgcatgatcatgatggagatgaccgacttcacgagg
gggaaaggaccactaaagcataccactgatgtaatctatgcagctaagatgatatcagag
tcaggatcaaggatggatgttcttgctcggcaaattgctaaccagtgtccagatccaccg
tgcaaacaggacttgctggcttacctggaacagattaaattctactcccaccagctgaaa
atctgcagtcaagttaaagcagagatccaaaacctggggggagaactcatcgtatcagct
ttggacagtgtcacctccctgatccaggcagccaagaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcatacattgcttccaccaagatcatccgcatccagagttctgcagga
ccccggcacccagttgtcatgtggaggatgaaggctccagctaagaagcccttgattaaa
agagagaagccagaagaaacatgggcagctgtcagaagaggctctgccaagaaaaagatc
cacccagttcaagtcatgagtgaattcagagggagacaagtctactga

KEGG   Mus pahari (shrew mouse): 110333109
Entry
110333109         CDS       T05929                                 

Gene name
Ctnna1
Definition
(RefSeq) catenin alpha-1 isoform X1
  KO
K05691  catenin alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04670  Leukocyte transendothelial migration
mpah05100  Bacterial invasion of epithelial cells
mpah05200  Pathways in cancer
mpah05213  Endometrial cancer
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110333109 (Ctnna1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110333109 (Ctnna1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110333109 (Ctnna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333109 (Ctnna1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110333109 (Ctnna1)
   05213 Endometrial cancer
    110333109 (Ctnna1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110333109 (Ctnna1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110333109 (Ctnna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110333109 (Ctnna1)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     110333109 (Ctnna1)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 110333109
NCBI-ProteinID: XP_021070199
Ensembl: MGP_PahariEiJ_G0018838
LinkDB
Position
15
AA seq 906 aa
MTAVHTGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDAAQHQGGSGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgccgtccacacaggcaacataaacttcaaatgggaccccaaaagtctggagatc
aggactctggctgttgaaagactgttggagcctcttgttacacaggttacaactctggta
aacaccaatagtaaagggccctctaataagaagaggggccggtctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggaaaagggggataaaattgca
aaagagagccagtttctcaaggaagagcttgtggttgctgtagaagatgttcgaaaacaa
ggagatttgatgaagagcgctgctggggagtttgcagatgatccatgctcttctgtgaag
cgaggcaacatggtccgggcagctcgagctttgctctctgccgtcacccggctgctgatt
ctggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atattgaaactgaggaatgctggcaatgaacaagacttagggatacagtacaaagctctg
aaaccagaagtagataagctgaacatcatggcagcaaaaagacaacaggaactgaaagat
gtgggcaatcgtgatcagatggctgcagctagaggaatcctgcagaaaaatgttcctatc
ctctatactgcatcccaggcatgcctacaacaccccgatgttgcagcctacaaggccaac
cgggacttgatatacaagcagctgcagcaggctgtcacaggaatttctaatgcagcccag
gctactgcgtcagatgatgctgcccagcaccagggtggcagcggcggagagctggcatac
gctctcaacaactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttagaccatccctggaggagcgcctggaaagcattattagtggggctgccctgatggct
gactcatcctgcacacgtgatgaccggcgggagcgcattgtggcagagtgtaatgctgtc
cgccaggctctgcaggacctgctctcagaatacatgggcaacgctggacgtaaagagaga
agtgatgcactaaactctgcaatagataaaatgaccaagaagaccagggacctgcgcaga
cagcttcgcaaagctgtcatggaccacgtatcggattctttcctggagaccaatgtccct
cttttagtactgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagtttttcgtgaacatgccaacaaactgattgaggtcgccaacctggcctgttcaatc
tccaacaatgaagaaggcgtgaagctcgtccgaatgtctgcaagccagttagaagcactg
tgtcctcaggtcatcaatgctgcgttggctttagcagcaaagccacagagtaaactggcc
caagagaacatggatctttttaaagagcagtgggaaaagcaagtccgtgttctcacagat
gctgttgatgacattacttccatcgatgacttcttggctgtctcagagaaccacatttta
gaagatgtgaacaagtgtgttattgctctccaagagaaagatgtggatgggctggatcga
actgctggtgccatccgaggccgagcagcccgagtcattcatgtagtcacctcagagatg
gacaactacgagccaggagtttatacagagaaggttctggaagccaccaagctcctctcc
aacacagtcatgccacgtttcactgagcaagtggaagcagctgtggaagccctcagctcg
gacccagcccagcccatggatgagaatgagttcatcgatgcctcccgtctggtgtacgac
ggcatccgggacatccgaaaagcagtgctgatgataaggacccccgaggagttggacgac
tctgacttcgagactgaagactttgatgtcagaagcaggacaagtgtccagacagaagat
gaccagctgatagctggccagagcgcccgggcgatcatggctcagcttcctcaggagcaa
aaagcaaagattgcagaacaggtggccagcttccaggaagaaaagagcaaactggatgct
gaagtgtccaagtgggatgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgatcatgatggagatgacggacttcacccgaggcaaagggccgctcaaaaacacttct
gatgtgatcagtgctgccaagaaaattgctgaggcaggatcaaggatggacaagctcggc
cggaccatcgcagatcattgcccagactcggcctgcaagcaggacctgctggcctatctt
cagcgcatcgctctctactgccaccagctcaacatctgcagcaaagtcaaggctgaagta
cagaaccttggtggagagcttgtcgtctctggggtggacagcgccatgtccctgatccag
gcggccaagaacttgatgaacgctgtcgtacagacagtgaaagcgtcctacgtggcttcc
accaaataccagaagtcacaggggatggcgtccctgaaccttcctgctgtgtcatggaag
atgaaggcccctgagaagaagccgttggtgaagagagagaagcaggatgagacgcagacc
aagattaagcgagcctctcagaagaaacacgtgaaccccgtgcaggccctcagcgagttc
aaagccatggacagcatctga

DBGET integrated database retrieval system