KEGG   Mus pahari (shrew mouse): 110316305
Entry
110316305         CDS       T05929                                 

Gene name
Wnt7a
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316305 (Wnt7a)
   04390 Hippo signaling pathway
    110316305 (Wnt7a)
   04150 mTOR signaling pathway
    110316305 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110316305 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110316305 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316305 (Wnt7a)
   05205 Proteoglycans in cancer
    110316305 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316305 (Wnt7a)
   05226 Gastric cancer
    110316305 (Wnt7a)
   05217 Basal cell carcinoma
    110316305 (Wnt7a)
   05224 Breast cancer
    110316305 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110316305 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316305 (Wnt7a)
   05022 Pathways of neurodegeneration - multiple diseases
    110316305 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110316305 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110316305 (Wnt7a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110316305 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 110316305
NCBI-ProteinID: XP_021046168
Ensembl: MGP_PahariEiJ_G0022398
LinkDB
Position
2
AA seq 349 aa
MTRKARRCLGHLFLSLGIVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatagtctac
ctccggatcggtggcttctcttcggtggtagctctgggtgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcaatctgccagagccggccggacgccatcatc
gtcataggagaaggctcccaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgttggaactgctcagcgctgggagagcgtactgtcttcgggaaggagctcaaagtgggg
agtcgggaggccgccttcacctatgcgatcatcgctgcgggtgtggcccatgccatcact
gctgcctgcacccagggcaacctgagcgactgtggctgcgacaaggagaagcaaggccag
taccatcgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtcttcgtggatgcccgggagatcaagcagaatgcccggaccctcatg
aacttacacaataacgaggcgggccggaagatcctggaggagaacatgaagctggagtgt
aagtgccatggtgtgtcaggctcctgtaccactaagacatgctggaccacactgccacaa
ttccgagaactaggctacgtgctcaaggataaatacaacgaggccgtccacgtggagcct
gtgcgtgccagtcgaaacaagcggcccacctttctgaagatcaagaagcccctgtcctac
cgcaagcccatggacaccgacctggtgtacattgagaagtcacccaattactgtgaagag
gacccagtgacaggcagcgtgggtacccagggccgggcctgcaataagacagcccctcag
gccagtggctgtgacctcatgtgctgcggccgtggctacaacacgcaccagtacgcccgg
gtgtggcagtgcaactgcaaattccactggtgctgctacgtcaagtgtaacacgtgcagc
gagcgcacggagatgtatacgtgcaagtga

KEGG   Mus pahari (shrew mouse): 110316416
Entry
110316416         CDS       T05929                                 

Gene name
Wnt2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316416 (Wnt2)
   04390 Hippo signaling pathway
    110316416 (Wnt2)
   04150 mTOR signaling pathway
    110316416 (Wnt2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110316416 (Wnt2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110316416 (Wnt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316416 (Wnt2)
   05205 Proteoglycans in cancer
    110316416 (Wnt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316416 (Wnt2)
   05226 Gastric cancer
    110316416 (Wnt2)
   05217 Basal cell carcinoma
    110316416 (Wnt2)
   05224 Breast cancer
    110316416 (Wnt2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110316416 (Wnt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316416 (Wnt2)
   05022 Pathways of neurodegeneration - multiple diseases
    110316416 (Wnt2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110316416 (Wnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110316416 (Wnt2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110316416 (Wnt2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110316416
NCBI-ProteinID: XP_021046370
Ensembl: MGP_PahariEiJ_G0021877
LinkDB
Position
2
AA seq 360 aa
MNVPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSRGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWATPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgtccctctcggtggaatctggctgtggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtcatg
tgtgacaatgtgccaggcctggtgagccggcagcgtcagctgtgccaccgacacccagac
gtgatgcgtgccattggcctgggtgtggctgagtggacagcagagtgccagcaccagttt
cgacagcatcgctggaactgcaacaccctggacagagatcacagcctctttggccgggtc
ctcctccgaagtagtcgggaatcggcctttgtttacgccatctcttcagctggcgttgta
tttgccatcaccagggcctgtagccaaggagaattaaagtcctgttcctgtgatccaaag
aagaaaggaagtgccaaggacagcagaggcaccttcgattggggtggctgcagtgacaat
attgactacgggatcaagtttgcccgtgcctttgtagatgccaaggagaggaaaggcaag
gatgccagagccctgatgaaccttcacaacaacagagctggaaggaaggctgtaaagcgc
ttcttgaaacaagaatgcaagtgtcatggtgtaagcggctcctgtactctgaggacatgc
tggctggccatggctgacttcaggaaaacaggcgactatctctggaggaagtacaacggg
gccatccaggtagtcatgaaccaggatggcactggcttcactgtagccaataagaggttt
aagaagccaacaaaaaatgacctcgtgtatttcgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacttgacttcccgaggc
atggacagctgtgaagttatgtgttgtgggagaggctatgacacatcccacgtcacccgg
atgaccaagtgtgagtgcaaattccactggtgctgtgccgtgcgctgtcaggactgcctg
gaggccctggacgtgcacacatgcaaggcccccaagagtgccgactgggcgactcctaca
tga

KEGG   Mus pahari (shrew mouse): 110316538
Entry
110316538         CDS       T05929                                 

Gene name
Wnt5b
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110316538 (Wnt5b)
   04390 Hippo signaling pathway
    110316538 (Wnt5b)
   04150 mTOR signaling pathway
    110316538 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110316538 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110316538 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    110316538 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316538 (Wnt5b)
   05205 Proteoglycans in cancer
    110316538 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110316538 (Wnt5b)
   05226 Gastric cancer
    110316538 (Wnt5b)
   05217 Basal cell carcinoma
    110316538 (Wnt5b)
   05224 Breast cancer
    110316538 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110316538 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316538 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    110316538 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110316538 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110316538 (Wnt5b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110316538 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110316538
NCBI-ProteinID: XP_021046563
Ensembl: MGP_PahariEiJ_G0022548
LinkDB
Position
2
AA seq 372 aa
MLVPGHWDGLRPAMPSLLLLVVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPV
CSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNASVFGRVM
QIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEY
GYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVSCKCHGVSGSCS
LKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDY
CLRNETTGSLGTRGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCK
KCTEVVDQHVCK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttggtcccagggcattgggatgggttgaggccagccatgcccagcctgctgctgctg
gtcgtggcagctctgctctccagctgggcacagctgctgactgatgccaactcctggtgg
tcgctagctctgaacccggtgcagagaccggagatgttcatcattggcgctcagcccgtg
tgcagtcaacttcctgggctttccccaggccagagaaagctgtgtcagctgtatcaggag
cacatgtcctacatcggggagggagccaagacgggcatcagagagtgccagcaccagttt
cgacagaggcgctggaactgcagcaccgtggacaatgcatctgtctttggcagagttatg
cagataggtagccgggagactgccttcacgtatgcagtgagcgctgctggcgtggtgaat
gccatcagccgagcctgcagagagggtgagctgtccacctgtggctgcagccgtgctgca
aggcccaaggacctgcctcgggactggctgtggggtggctgtggagacaacgtggagtac
ggctaccgctttgccaaggagtttgtggatgcccgagagcgtgagaagaactttgccaag
ggatcggaggagcagggccgggccctcatgaacctacagaacaatgaggctggccgccgg
gccgtgtataagatggctgatgtctcctgcaaatgtcacggagtctccgggtcctgcagc
ctcaagacctgctggctccagctggcggagttccgcaaggtgggggaccgcttaaaggag
aagtacgacagcgccgcggccatgcgcatcacccgccagggcaagctggagctggccaac
agccgcttcaaccagcccaccccggaggacctggtctacgtggaccccagccctgactac
tgcctgcgcaatgagaccacgggctccctgggcactcggggtcgcctctgcaacaagacc
tcagagggcatggatggctgcgagctcatgtgctgcggccgcggctatgaccgcttcaag
agcgtccaggtggaacgctgccactgcaggttccactggtgctgctttgtcaggtgcaaa
aaatgcacggaggttgtggaccagcatgtctgtaagtga

KEGG   Mus pahari (shrew mouse): 110317136
Entry
110317136         CDS       T05929                                 

Gene name
Wnt16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110317136 (Wnt16)
   04390 Hippo signaling pathway
    110317136 (Wnt16)
   04150 mTOR signaling pathway
    110317136 (Wnt16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110317136 (Wnt16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110317136 (Wnt16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317136 (Wnt16)
   05202 Transcriptional misregulation in cancer
    110317136 (Wnt16)
   05205 Proteoglycans in cancer
    110317136 (Wnt16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110317136 (Wnt16)
   05226 Gastric cancer
    110317136 (Wnt16)
   05217 Basal cell carcinoma
    110317136 (Wnt16)
   05224 Breast cancer
    110317136 (Wnt16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110317136 (Wnt16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317136 (Wnt16)
   05022 Pathways of neurodegeneration - multiple diseases
    110317136 (Wnt16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110317136 (Wnt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110317136 (Wnt16)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110317136 (Wnt16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110317136
NCBI-ProteinID: XP_021047188
Ensembl: MGP_PahariEiJ_G0021887
LinkDB
Position
2
AA seq 364 aa
MDRAALLALPSLCALWAAVLSLLPCGTQGNWMWLGIASFGVPEKLGCTGLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATATSTQLDTAPLFGYELSSGTKETA
FIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSEGWHWGGCSDDVQYGMWFSRK
FLDLPIRNATGKESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSS
FEKIGHFLKDKYENSIQISDKTKRKMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLG
IPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDV
HTCK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacagagcggcgctcctggccctgcccagcttgtgtgcgctgtgggcagcggtgctg
tcgctgctcccctgcggaacccagggcaactggatgtggttgggcatcgcctccttcggg
gtaccggagaagctgggctgcaccggcttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctacctagcatccgcgagggcgccaggctgggcattcaggag
tgcagaagccagttccggcacgagaggtggaactgtatggtcgccactgccacctccacc
cagctcgacacagctcccctctttggttatgagctgagtagtggcaccaaggagacagca
ttcatttatgccatcatggcggcaggcctggtgcactccgtaaccaggtcatgcagtgca
ggaaacatgactgaatgttcctgtgacaccaccttgcagaatggtggctcgccaagtgaa
ggctggcactggggaggatgctctgatgatgtccagtacggcatgtggttcagcagaaag
tttctagatctccccatcagaaacgccacaggaaaagaaagcaaagtcctgctggccatg
aatctacacaacaacgaagcagggcggcaggctgtcgccaagttaatgtctgtggattgc
cgctgccacggagtttccggctcctgtgctgtgaaaacctgctggaaaactatgtcttct
tttgaaaagattgggcattttttaaaggataaatatgaaaacagcatccagatctcagac
aaaaccaagaggaaaatgcgcaggagagaaaaagatcagaggcagacacccattctcaag
gatgacctgctgtacgttcataagtctcccaactactgcgtggagaacaagaaactgggt
attcctgggacacagggcagagagtgcaaccggacatcaggaggcgcggatggctgtaac
ctcctctgctgtggcagaggctacaacacccatgtagtcaggcacgtggagaggtgtgag
tgtaagtttatctggtgctgctacgtccgctgcaggaggtgtgaaagtatgaccgatgtc
cacacgtgtaagtaa

KEGG   Mus pahari (shrew mouse): 110320339
Entry
110320339         CDS       T05929                                 

Gene name
Wnt2b
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110320339 (Wnt2b)
   04390 Hippo signaling pathway
    110320339 (Wnt2b)
   04150 mTOR signaling pathway
    110320339 (Wnt2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110320339 (Wnt2b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110320339 (Wnt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320339 (Wnt2b)
   05205 Proteoglycans in cancer
    110320339 (Wnt2b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110320339 (Wnt2b)
   05226 Gastric cancer
    110320339 (Wnt2b)
   05217 Basal cell carcinoma
    110320339 (Wnt2b)
   05224 Breast cancer
    110320339 (Wnt2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110320339 (Wnt2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110320339 (Wnt2b)
   05022 Pathways of neurodegeneration - multiple diseases
    110320339 (Wnt2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110320339 (Wnt2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320339 (Wnt2b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110320339 (Wnt2b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110320339
NCBI-ProteinID: XP_021051951
Ensembl: MGP_PahariEiJ_G0026915
LinkDB
Position
4
AA seq 393 aa
MLKLQGEDEAAQLAPRRARVPVPVPVPRPTAPDVSPSSARLGLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagctgcagggtgaggacgaagccgcgcagctcgcccctcggcgtgcccgcgtc
cccgtccccgtccccgtgcccagacccacggcccccgacgtgtccccatcttctgcccgc
ctgggtcttgcctgcctgctgctgctgctgctcctgactctgccggcccgtgtagacacg
tcctggtggtacataggggcactgggagcccgagtgatctgtgacaacatccccggtctg
gtgagccggcagcggcagttgtgccagcgctacccagacatcatgcgctcagtaggtgaa
ggtgcccgggaatggatccgagagtgtcagcaccagttccgccatcaccgctggaattgc
accacactggaccgggaccacactgtctttggccgtgccatgctcagaagcagccgggag
gcagcgttcgtctatgctatctcatcagcaggagtggtccacgccatcactcgggcctgc
agccagggtgagctgagcgtgtgcagctgtgacccatatacccgtggtcggcaccatgat
caacgaggggactttgactggggtggctgtagcgacaacatccactacggtgtccgcttt
gccaaggcttttgtggatgccaaagagaagaggcttaaggatgcccgggccctcatgaac
ttacacaacaaccgctgtggtcgcacggcggtgcggagattcctgaagctggagtgcaag
tgtcacggtgtgagtggctcctgtactctgcgcacctgctggagggcactctcagacttc
cgccgcacaggtgactacctgaggaggcgatatgatggggctgtgcaggtgacggccacg
caggatggggccaatttcacagcagcccgccaaggctatcgccacgccacccggactgat
cttgtctactttgacaactcccctgactactgtgtcttggacaaggctgcaggttcccta
ggtaccgcaggccgcgtctgcagcaagacttctaaaggaacagatgggtgtgaaatcatg
tgttgcggccgagggtatgacacaactcgggtcacccgtgtcacccagtgtgagtgcaaa
ttccactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggatgttcacacg
tgcaaggcccctaagaaggcagagtggctggaccagacctga

KEGG   Mus pahari (shrew mouse): 110321884
Entry
110321884         CDS       T05929                                 

Gene name
Wnt6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110321884 (Wnt6)
   04390 Hippo signaling pathway
    110321884 (Wnt6)
   04150 mTOR signaling pathway
    110321884 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110321884 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110321884 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321884 (Wnt6)
   05205 Proteoglycans in cancer
    110321884 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110321884 (Wnt6)
   05226 Gastric cancer
    110321884 (Wnt6)
   05217 Basal cell carcinoma
    110321884 (Wnt6)
   05224 Breast cancer
    110321884 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110321884 (Wnt6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110321884 (Wnt6)
   05022 Pathways of neurodegeneration - multiple diseases
    110321884 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110321884 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110321884 (Wnt6)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110321884 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110321884
NCBI-ProteinID: XP_021054127
Ensembl: MGP_PahariEiJ_G0027512
LinkDB
Position
5
AA seq 364 aa
MLPPVPSGLGLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEV
VAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVT
QACSMGELLQCGCQAPRGRAPPRPSGLLGTPVPPGPTGSPDASAAWEWGGCGDDVDFGDE
KSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLP
PFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPSRADLLYAADSPDFCAPNRRTG
SPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKEL
SLCL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgctgccgccggtgccctccggcctcggactgctgctgctgctcttgtgcccggcgcac
gtcggtggactgtggtgggccgtgggcagccccctggtcatggatcctaccagcatctgc
aggaaggccaggcggctggcaggaaggcaggctgagctgtgccaggcagagccggaagta
gtggcagagcttgcccgaggcgcaagactgggggttcgagaatgtcagttccagttccgt
ttccgacgctggaactgctccagtcacagcaaggcctttgggcgcgtcctgcagcaggac
attcgagagacagcttttgtgtttgcaatcaccgcagcaggtgccagccacgcagtcact
caagcctgttccatgggagagctcctacagtgtggttgtcaggcaccccgggggcgggca
ccgcctaggccctccggccttctgggcactcctgtacctccagggccaactggctctcca
gatgccagcgcagcctgggagtggggaggctgcggagacgacgtggacttcggggatgag
aagtcaagactctttatggatgcgcagcacaagcggggccgtggagatatccgtgcattg
gtgcaactgcacaacaacgaggcgggcaggctggctgtgaggagccacacgcgcaccgag
tgtaagtgccacgggctttcgggttcctgcgctctgcgcacctgctggcagaagctgcct
ccgttccgcgaggtgggcgcacggctgctggagcgcttccacggcgcctcgcgcgtcatg
ggcaccaacgacggcaaagctctactgcctgcggtccgcacactcaagcctcccagccga
gcggatctcctctacgcagccgattcacccgacttctgcgcccccaaccggcgcaccggt
tcgccgggcacgcgtggccgcgcctgcaacagcagtgccccggacctcagcggctgcgac
ctgttgtgctgcggtcgcgggcaccgccaggagagcgtacagctcgaggagaactgtctg
tgccgcttccactggtgctgcgtggtgcaatgccaccgctgccgcgtgcgcaaggaactc
agcctgtgcctctga

KEGG   Mus pahari (shrew mouse): 110322230
Entry
110322230         CDS       T05929                                 

Gene name
Wnt10a
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110322230 (Wnt10a)
   04390 Hippo signaling pathway
    110322230 (Wnt10a)
   04150 mTOR signaling pathway
    110322230 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110322230 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110322230 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322230 (Wnt10a)
   05205 Proteoglycans in cancer
    110322230 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110322230 (Wnt10a)
   05226 Gastric cancer
    110322230 (Wnt10a)
   05217 Basal cell carcinoma
    110322230 (Wnt10a)
   05224 Breast cancer
    110322230 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110322230 (Wnt10a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110322230 (Wnt10a)
   05022 Pathways of neurodegeneration - multiple diseases
    110322230 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110322230 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110322230 (Wnt10a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110322230 (Wnt10a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110322230
NCBI-ProteinID: XP_021054478
Ensembl: MGP_PahariEiJ_G0027513
LinkDB
Position
5
AA seq 417 aa
MGSAHPRPWLRLPPGPQPRPEFWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPAVLPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSTGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctcccaccagggccccagccgcggcct
gagttctgggcgctcctgttcttcctactgctgctggctgccgctgtgcccaggtcagca
cccaacgacatcctgggcctccgcctacccccagagcctgtgctcaacgccaacacagtg
tgcctgacattgcccggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgac
gtggccgcctctgctatccagggcatccagatcgccatccatgagtgccagcatcagttc
cgggaccagcgctggaactgctccagcctggagactcggaacaaagtcccctacgagagc
cccatcttcagcagaggttttcgagagagtgctttcgcctacgccatagcagctgccggg
gtggtgcacgccgtatccaacgcttgcgctctgggtaaactgaaggcttgcggttgcgac
gcctccaggcgtggggacgaagaggccttccgtcggaagctgcaccgcttgcagctggac
gcgctgcagcgcggaaagggcttgagccacggggtccctgaacacccggccgtactccct
gccagcccaggcctgcaggactcctgggagtggggtggctgcagtccggatgtgggcttc
ggagaacgcttctctaaggactttctggactcccgagagcctcacagagacatccacgca
cgaatgagactccacaacaaccgtgtgggccggcaggcggtgatggagaacatgcggcga
aagtgcaaatgccacggcacctcaggcagctgccagctcaagacctgctggcaggtgacg
cctgagttccgcacagtgggggcgctgctgcgcaaccgcttccaccgcgccacgctcatc
cggcctcacaaccgtaacggtggccagctggagcccggccctgcgggagcaccctcgcca
gcaccgggcgctccagggctgcgccgcagggccagccactccgacctggtctactttgag
aaatcgcccgacttctgtgagcgcgagccgcgcctggactcggcaggcactgtgggccgt
ctgtgcaataagagcagcaccggtccggatggctgcggcagcatgtgctgtggtcgcggc
cacaacattctgcgccagacgcgcagcgagcgctgccactgccggttccactggtgctgc
ttcgtggtctgcgaagaatgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Mus pahari (shrew mouse): 110323343
Entry
110323343         CDS       T05929                                 

Gene name
Wnt4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04919  Thyroid hormone signaling pathway
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110323343 (Wnt4)
   04390 Hippo signaling pathway
    110323343 (Wnt4)
   04150 mTOR signaling pathway
    110323343 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110323343 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110323343 (Wnt4)
   04916 Melanogenesis
    110323343 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    110323343 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323343 (Wnt4)
   05205 Proteoglycans in cancer
    110323343 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110323343 (Wnt4)
   05226 Gastric cancer
    110323343 (Wnt4)
   05217 Basal cell carcinoma
    110323343 (Wnt4)
   05224 Breast cancer
    110323343 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110323343 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323343 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    110323343 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110323343 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110323343 (Wnt4)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110323343 (Wnt4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 110323343
NCBI-ProteinID: XP_021056172
Ensembl: MGP_PahariEiJ_G0029006
LinkDB
Position
6
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccccgttcgtgcctgcggtccctgcgactcctcgtcttcgccgtgttctcggcc
gccgcgagcaactggctgtacctggccaagctgtcgtcggtgggcagcatctccgaagag
gagacgtgcgagaagctcaaaggcctgatccagaggcaggtgcagatgtgcaaacggaac
ctcgaggtgatggactcagtgcgccgcggtgcccagctggccatcgaggagtgccaatac
cagttccggaatcggcgctggaactgttccacactggactccctgcctgtctttgggaag
gtggtgacacaagggacccgggaggcggccttcgtatatgccatctcttcggcaggcgtg
gcctttgcagtgacaagggcgtgcagcagcggtgagctggagaagtgcggctgtgaccgg
acagtgcacggggtcagcccacagggcttccagtggtcaggatgctcggacaacatcgcc
tatggcgtagccttctcacagtcttttgtggacgtccgggagaggagcaagggggcctcc
tccagccgggcactcatgaaccttcacaacaacgaggctggcaggaaggctatcttgaca
cacatgcgggtggagtgcaagtgccatggggtgtcgggctcctgcgaggtaaagacgtgc
tggcgtgctgtaccgcccttccgccaggttggccacgcgctaaaggagaagtttgacggt
gccacggaggtggagccacgtcgcgtaggctcctcccgggcgctggtgccgcggaatgca
cagttcaagccacatacagatgaggacctggtatacctggagcccagtccggacttctgt
gagcaggacatccgcagtggcgtgctaggcacgaggggccgcacgtgcaacaagacatct
aaggccattgatggctgcgagctactgtgctgcggccgcggcttccacacagcacaggtg
gagctggctgagcgctgcggctgcaggttccattggtgctgctttgtcaagtgccggcag
tgccagcggctcgtggagatgcacacgtgccggtga

KEGG   Mus pahari (shrew mouse): 110325401
Entry
110325401         CDS       T05929                                 

Gene name
Wnt11
Definition
(RefSeq) protein Wnt-11 isoform X1
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110325401 (Wnt11)
   04390 Hippo signaling pathway
    110325401 (Wnt11)
   04150 mTOR signaling pathway
    110325401 (Wnt11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325401 (Wnt11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110325401 (Wnt11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325401 (Wnt11)
   05205 Proteoglycans in cancer
    110325401 (Wnt11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110325401 (Wnt11)
   05226 Gastric cancer
    110325401 (Wnt11)
   05217 Basal cell carcinoma
    110325401 (Wnt11)
   05224 Breast cancer
    110325401 (Wnt11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110325401 (Wnt11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325401 (Wnt11)
   05022 Pathways of neurodegeneration - multiple diseases
    110325401 (Wnt11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325401 (Wnt11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110325401 (Wnt11)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110325401 (Wnt11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110325401
NCBI-ProteinID: XP_021059036
Ensembl: MGP_PahariEiJ_G0013242
LinkDB
Position
1
AA seq 354 aa
MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
TISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggctctgctctttgctctggcgctccacaccggc
gtgtgctatggcatcaagtggctggcactgtccaagactccggcagccttggcactgaat
cagacgcaacactgtaaacagctggagggcctggtgtctgcgcaggtgcagctctgccgc
agcaacctggagctcatgcgcaccatcgtgcacgccgcgcgggaggccatgaaggcctgc
cgccgggcctttgctgacatgcgctggaactgttcctccatcgagctcgcccccaactac
ctgcttgacctggagagaggtacccgggagtcagccttcgtgtatgccctgtcggccgcc
accatcagtcacaccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctacgtgcctccctggaaacgaagtgtaaatgccatggggtctctggctcctgctccatc
cgcacctgttggaaggggctgcaagagctccgggatgtggctgctgacctcaagacccgc
tacctgtcagccacgaaggtggtacaccggcctatgggcactcgcaagcacttggtgccc
aaggacctggatatccggcctgtgaaggactcagaactagtgtatctacagagctcccct
gacttctgcatgaagaatgagaaggtgggatcccatgggacccaagacaggcagtgcaac
aagacctccaacggcagtgacagctgcgacctcatgtgctgtgggcgcggctacaacccc
tacacggacagagtggtggagcgatgtcactgcaagtaccactggtgttgctatgtcacc
tgccgcaggtgtgagcgcacggtggagcgctatgtctgcaagtga

KEGG   Mus pahari (shrew mouse): 110325571
Entry
110325571         CDS       T05929                                 

Gene name
Wnt5a
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110325571 (Wnt5a)
   04390 Hippo signaling pathway
    110325571 (Wnt5a)
   04150 mTOR signaling pathway
    110325571 (Wnt5a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325571 (Wnt5a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110325571 (Wnt5a)
  09158 Development and regeneration
   04360 Axon guidance
    110325571 (Wnt5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325571 (Wnt5a)
   05205 Proteoglycans in cancer
    110325571 (Wnt5a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110325571 (Wnt5a)
   05226 Gastric cancer
    110325571 (Wnt5a)
   05217 Basal cell carcinoma
    110325571 (Wnt5a)
   05224 Breast cancer
    110325571 (Wnt5a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110325571 (Wnt5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325571 (Wnt5a)
   05022 Pathways of neurodegeneration - multiple diseases
    110325571 (Wnt5a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325571 (Wnt5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110325571 (Wnt5a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110325571 (Wnt5a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110325571
NCBI-ProteinID: XP_021059291
Ensembl: MGP_PahariEiJ_G0030059
LinkDB
Position
8
AA seq 380 aa
MKKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagcccattggaatattaagcccgggagtggctttggggaccgctggaggtgcc
atgtcttccaagttcttcctaatggctttggccacgtttttctccttcgcccaggttgtt
atagaagctaattcttggtggtctctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggtgcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactctgtcacttgtatcaggaccacatgcagtacattggagaaggtgcgaagacaggc
atcaaggaatgccagtaccagttccggcatcggagatggaactgcagcacagtggacaat
acttctgtctttggcagggtgatgcaaataggcagccgagagacggccttcacgtacgcg
gtgagcgcagctggagtggtgaacgccatgagccgagcatgccgggagggcgagctgtct
acctgtggctgcagtcgtgctgcgcgccccaaggacctgcctcgggactggttgtggggc
ggctgcggggacaacatcgactatggctaccgcttcgccaaggagttcgtggacgctaga
gaaagggaacgaatccatgccaagggctcctatgagagcgcacgcatcctcatgaactta
cacaacaatgaagcaggccgcaggacagtatacaacctggcagatgtagcctgtaagtgt
catggagtgtctggctcgtgtagcctcaagacgtgctggctgcagctcgcggacttccgg
aaggtgggcgatgccctcaaggagaagtatgatagcgcagcagccatgaggctcaacagc
cggggcaagctggtgcaggtcaacagtcgcttcaactccccgaccacacaggacctggtc
tacatcgatccaagtccggactactgtgtgcgcaacgagagcactggctcactgggcaca
cagggacgcctgtgcaacaagacctcagaggggatggatggctgcgagctcatgtgctgt
gggcgtggctatgaccaatttaagaccgtgcagaccgaacgctgtcattgcaagtttcac
tggtgctgctatgtcaaatgcaagaagtgcacggagattgtggatcagttcgtgtgcaaa
tag

KEGG   Mus pahari (shrew mouse): 110330357
Entry
110330357         CDS       T05929                                 

Gene name
Wnt8b
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110330357 (Wnt8b)
   04390 Hippo signaling pathway
    110330357 (Wnt8b)
   04150 mTOR signaling pathway
    110330357 (Wnt8b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110330357 (Wnt8b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110330357 (Wnt8b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330357 (Wnt8b)
   05205 Proteoglycans in cancer
    110330357 (Wnt8b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110330357 (Wnt8b)
   05226 Gastric cancer
    110330357 (Wnt8b)
   05217 Basal cell carcinoma
    110330357 (Wnt8b)
   05224 Breast cancer
    110330357 (Wnt8b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110330357 (Wnt8b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110330357 (Wnt8b)
   05022 Pathways of neurodegeneration - multiple diseases
    110330357 (Wnt8b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330357 (Wnt8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110330357 (Wnt8b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110330357 (Wnt8b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110330357
NCBI-ProteinID: XP_021066003
Ensembl: MGP_PahariEiJ_G0014489
LinkDB
Position
1
AA seq 368 aa
MLPISQCLSRPSCVSLKTMFLMKPVCVLLVTCVLHRSHAWSVNNFLMTGPKAYLVYSSSV
AAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRN
CSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLH
NNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG
AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE
RRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGA
AHKPGKNP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcttcctatctctcaatgtttgagtcgtccttcctgcgtttctctgaagactatgttt
cttatgaagcctgtgtgcgttcttctagtcacttgtgtccttcaccgcagccacgcctgg
tcagtgaacaattttctgatgaccggtccaaaggcttacctggtctactccagcagcgtg
gccgctggtgcccagagtggtattgaagaatgtaaataccagtttgcttgggaccgttgg
aattgccctgagagagctttacagctatccagccatggtggacttcggagcgctaaccgg
gagacagcgtttgtgcacgccatcagttctgctggagttatgtacaccctgactagaaac
tgtagcctcggggactttgacaactgtggctgtgatgactcccgaaatggacaactggga
ggccaaggttggctctggggaggctgcagtgacaacgtgggcttcggagaggcaatttcc
aagcagtttgtggatgccctcgagacaggacaggatgcccgggcagccatgaatctgcac
aacaatgaggctggccgcaaggcggtcaagggcaccatgaaacgcacgtgtaagtgccac
ggtgtgtccggcagctgcaccacgcagacctgctggttgcaactgccagagttccgggaa
gtaggcgcgcacttgaaggagaagtatcacgcggcgctcaaggtggacctgctgcagggc
gcgggcaacagcgcggcgggccgcggcgccatcgccgacaccttccgctccatctccaca
cgcgagctggtgcatctggaggactccccagactactgcctggagaacaagaccctgggg
ctgctgggcaccgagggccgagagtgtctgcggcgcgggcgcgccctgggtcgctgggag
cgccgcagttgtcgccggctgtgcggggactgcgggctagcggtggaggagcgccgcgcc
gagacagtgtccagctgcaactgcaagtttcactggtgctgcgcggtccgatgcgagcag
tgccgccggcgggtcaccaagtacttctgcagccgcgcagagcggccgcccagaggcgct
gcgcacaaacccgggaagaatccctaa

KEGG   Mus pahari (shrew mouse): 110331284
Entry
110331284         CDS       T05929                                 

Gene name
Wnt9a
Definition
(RefSeq) protein Wnt-9a isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331284 (Wnt9a)
   04390 Hippo signaling pathway
    110331284 (Wnt9a)
   04150 mTOR signaling pathway
    110331284 (Wnt9a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331284 (Wnt9a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110331284 (Wnt9a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331284 (Wnt9a)
   05205 Proteoglycans in cancer
    110331284 (Wnt9a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110331284 (Wnt9a)
   05226 Gastric cancer
    110331284 (Wnt9a)
   05217 Basal cell carcinoma
    110331284 (Wnt9a)
   05224 Breast cancer
    110331284 (Wnt9a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331284 (Wnt9a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331284 (Wnt9a)
   05022 Pathways of neurodegeneration - multiple diseases
    110331284 (Wnt9a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331284 (Wnt9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110331284 (Wnt9a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110331284 (Wnt9a)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 110331284
NCBI-ProteinID: XP_021067425
Ensembl: MGP_PahariEiJ_G0017563
LinkDB
Position
14
AA seq 365 aa
MLDGSLLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLETEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETSLKVGSTTNEATGEAGAISPPRGRASGSGGGDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtcccttctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctaacaggcagtgaacccctgact
atcctccctctgaccctggagacggaggctgcggcccaagcacactacaaggcctgcgac
aggctgaagctggagcgcaagcaacgccgcatgtgccgcagggacccgggcgtggccgag
acactggtggaggccgtaagcatgagtgccctggagtgccagtaccagttccgcttcgag
cgctggaactgcaccctggagggccgctaccgagccagcctgctcaagcgaggcttcaag
gagaccgctttcctctacgccatctcttccgcgggcctgacgcatgcactggctaaggcc
tgcagcgcaggccgcatggagcgctgcacttgtgacgaggcacccgacctggaaaaccgc
gaggcctggcagtggggcggctgcggggacaacctcaagtatagcagcaagtttgtcaag
gagttcctgggccggcgctctagcaaggatttgcgagcccgagtggacttccacaacaac
ctcgtgggtgtgaaggtgataaaggctggagtggaaaccacttgcaaatgccatggcgtg
tctggctcctgcaccgtgcggacctgctggcggcagctagcacccttccacgaggtgggc
aagcacctaaaacacaaatatgagacctcactcaaggtgggcagcactaccaatgaagcc
accggcgaggcaggtgccatctccccaccgcggggccgggcctctgggtcaggaggtggt
gacccactgccccgaacaccagagcttgtacacctggacgactctcccagcttctgcctg
gctggccgcttttctcctggcacggcaggccgcagatgtcaccgggagaagaactgtgag
agtatttgttgtggccgaggccacaacacacagagccgtgtggtgacaaggccctgccaa
tgccaggtccgctggtgctgctacgtggagtgcaggcagtgtacacagagagaggaggtc
tacacctgcaagggctga

KEGG   Mus pahari (shrew mouse): 110331285
Entry
110331285         CDS       T05929                                 

Gene name
Wnt3a
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331285 (Wnt3a)
   04390 Hippo signaling pathway
    110331285 (Wnt3a)
   04150 mTOR signaling pathway
    110331285 (Wnt3a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331285 (Wnt3a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110331285 (Wnt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331285 (Wnt3a)
   05206 MicroRNAs in cancer
    110331285 (Wnt3a)
   05205 Proteoglycans in cancer
    110331285 (Wnt3a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110331285 (Wnt3a)
   05226 Gastric cancer
    110331285 (Wnt3a)
   05217 Basal cell carcinoma
    110331285 (Wnt3a)
   05224 Breast cancer
    110331285 (Wnt3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331285 (Wnt3a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331285 (Wnt3a)
   05022 Pathways of neurodegeneration - multiple diseases
    110331285 (Wnt3a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331285 (Wnt3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110331285 (Wnt3a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110331285 (Wnt3a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110331285
NCBI-ProteinID: XP_021067427
Ensembl: MGP_PahariEiJ_G0017562
LinkDB
Position
14
AA seq 352 aa
MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggctcctctcggatacctcttagtgctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtctttggctgtgggaccccagtactcctccctgagcactcagcccatt
ctctgtgccagcatcccaggcctggtgcccaagcagctgcgcttctgcaggaactatgtg
gagatcatgcccagcgtggccgagggtgtcaaggcgggcatccaggagtgccagcaccag
ttccgaggccggcgttggaactgcaccacggtcagcaacagcctggccatctttggccct
gttctggacaaagccacccgagagtcggcctttgtccatgccatcgcttccgctggagtg
gccttcgcagtgacacgctcctgtgcagagggatcagctgccatctgtgggtgcagcagc
cgcctccagggctccccaggagagggctggaagtggggcggctgtagtgaggacattgaa
tttggaggaatggtctctcgggagtttgccgatgccagggagaaccggccggatgcccgc
tctgccatgaaccgtcacaacaatgaggctgggcgccaggccatcgccagtcatatgcac
ctcaagtgcaaatgccacgggctatctggcagctgtgaagtgaagacctgctggtggtcg
cagccggacttccgcaccatcggggatttcctcaaggacaagtatgacagcgcctcagag
atggtggtagagaaacaccgagagtctcgtggctgggtggagaccctgaggccacgttac
acgtacttcaaggtgccgacagagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagccgaaccccgaaaccggctccttcgggacgcgtgaccgcacctgcaatgtgagc
tcgcatggcatagacgggtgcgacctgttgtgctgcgggcgcgggcataacgcgcgcact
gagcgacggagggagaaatgccactgcgttttccactggtgctgctatgtcagctgccag
gagtgcacacgcgtctatgacgtgcacacctgcaagtag

KEGG   Mus pahari (shrew mouse): 110331952
Entry
110331952         CDS       T05929                                 

Gene name
Wnt3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331952 (Wnt3)
   04390 Hippo signaling pathway
    110331952 (Wnt3)
   04150 mTOR signaling pathway
    110331952 (Wnt3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331952 (Wnt3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110331952 (Wnt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331952 (Wnt3)
   05206 MicroRNAs in cancer
    110331952 (Wnt3)
   05205 Proteoglycans in cancer
    110331952 (Wnt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110331952 (Wnt3)
   05226 Gastric cancer
    110331952 (Wnt3)
   05217 Basal cell carcinoma
    110331952 (Wnt3)
   05224 Breast cancer
    110331952 (Wnt3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331952 (Wnt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331952 (Wnt3)
   05022 Pathways of neurodegeneration - multiple diseases
    110331952 (Wnt3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331952 (Wnt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110331952 (Wnt3)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110331952 (Wnt3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110331952
NCBI-ProteinID: XP_021068495
Ensembl: MGP_PahariEiJ_G0018416
LinkDB
Position
14
AA seq 355 aa
MEPHLLGLLLGLLLSGTRVLAGYPIWWSLALGQQYTSLASQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctactcggcctcctgctcagtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctggcctcc
cagcctctgctctgcggctccatcccgggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtagcagaaggcgtgaagctgggcatccaggagtgc
cagcatcagttccggggccgccgctggaactgtaccaccattgatgacagcctggccatc
tttgggcctgtcctggacaaagccacccgcgaatctgccttcgtgcatgccatcgcctcg
gctggggttgcctttgcagtcacacgctcctgtgctgagggaacctccaccatctgcggc
tgtgactcacatcataaggggccacctggagaaggctggaagtggggcggctgcagcgag
gacgccgacttcggggtgctggtgtcccgggagtttgcagatgcgcgggagaacaggcca
gatgcccgctcagctatgaacaagcacaacaatgaggccggccgaacgaccatcctggac
cacatgcacctgaagtgcaaatgccacgggttgtcgggcagctgcgaggtgaagacctgt
tggtgggcccagcccgactttcgtgccattggcgacttcctgaaggacaagtatgacagt
gcctccgagatggtggtggagaaacaccgtgagtcccgaggttgggtggagaccctgcgg
gccaagtatgcactcttcaagccgcccaccgagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggctcctttggtaccagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctgtgctgtggccggggccacaac
acgaggacggagaagcggaaggagaaatgccattgcgtcttccactggtgctgctatgtc
agctgccaagagtgtattcgcatctacgatgtgcacacctgcaagtag

KEGG   Mus pahari (shrew mouse): 110332442
Entry
110332442         CDS       T05929                                 

Gene name
Wnt9b
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110332442 (Wnt9b)
   04390 Hippo signaling pathway
    110332442 (Wnt9b)
   04150 mTOR signaling pathway
    110332442 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110332442 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110332442 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332442 (Wnt9b)
   05205 Proteoglycans in cancer
    110332442 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110332442 (Wnt9b)
   05226 Gastric cancer
    110332442 (Wnt9b)
   05217 Basal cell carcinoma
    110332442 (Wnt9b)
   05224 Breast cancer
    110332442 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110332442 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110332442 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    110332442 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110332442 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110332442 (Wnt9b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110332442 (Wnt9b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110332442
NCBI-ProteinID: XP_021069339
Ensembl: MGP_PahariEiJ_G0018415
LinkDB
Position
14
AA seq 360 aa
MRPAPALALAALCLLALPAAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDL
LKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETA
FLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFL
GPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQV
LKQRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYS
PGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcgccccgcgcccgcgctggccctggctgcgctctgcctgctggcgctgcctgccgct
gccgccgccgccgccgcctacttcggcctgaccggtcgtgaggtcctgacacccttccca
ggcctgggtacggcggcagccccggcccaggctggtgctcacctgaagcagtgtgacctg
ctgaagctgtccaggaggcagaagcagctctgcaggcgggagcctggcctggctgagacc
ctgagggatgccgcacacctggggctgctggaatgtcagttccagttcaggcaggagcgc
tggaactgcagcctggaggggaggactggcctgctccagagaggcttcaaggagacggcc
ttcctgtatgcggtgtctgcagctgccctcacgcatgcgctggccagggcctgcagtgct
gggcgcatggagcgctgtacctgtgacgactccccaggcctggagagccggcaggcctgg
cagtggggggtgtgtggtgacaacctgaagtacagcaccaagtttctcagcaacttcctg
gggcccaagagaggaagcaaggacctgagggcgagggctgacgcccacaacacccacgtg
ggcatcaaggctgtgaagagtggcctgagaacaacctgcaagtgccatggtgtgtcaggc
tcctgtgctgtgcgtacctgttggaagcaactctccccgtttcgcgagaccggccaggtg
ctgaagcaacgctatgacacggctgtcaaggtgtctagtgccaccaacgaggccttgggc
cgtctggagctatgggcccccgctaagccaggtggtcccgccaagggcctagccccccgt
cccggggacctggtctacatggaagattctcccagcttctgccggcccagcaagtactct
ccgggcacggcaggcagggtgtgttctcgagactccagctgcagcagcctatgctgcggg
cgaggctacgacacccagagccgcatggtggttttctcctgccactgtcaggtgcagtgg
tgctgctatgtggagtgccagcagtgtgcacagcaggagctcgtgtatacctgcaagcgc
tag

KEGG   Mus pahari (shrew mouse): 110333515
Entry
110333515         CDS       T05929                                 

Gene name
Wnt8a
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110333515 (Wnt8a)
   04390 Hippo signaling pathway
    110333515 (Wnt8a)
   04150 mTOR signaling pathway
    110333515 (Wnt8a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110333515 (Wnt8a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110333515 (Wnt8a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333515 (Wnt8a)
   05205 Proteoglycans in cancer
    110333515 (Wnt8a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110333515 (Wnt8a)
   05226 Gastric cancer
    110333515 (Wnt8a)
   05217 Basal cell carcinoma
    110333515 (Wnt8a)
   05224 Breast cancer
    110333515 (Wnt8a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333515 (Wnt8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110333515 (Wnt8a)
   05022 Pathways of neurodegeneration - multiple diseases
    110333515 (Wnt8a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110333515 (Wnt8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110333515 (Wnt8a)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110333515 (Wnt8a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110333515
NCBI-ProteinID: XP_021070735
Ensembl: MGP_PahariEiJ_G0018824
LinkDB
Position
15
AA seq 358 aa
MGRTMGHLLMLWVAAGMCYPALGASAWSVNNFLISGPKAYLTYTASVALGAQIGIEECKF
QFAWERWNCPEHAFQFSAHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDE
SQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDGLEKGKDTRALVNLHNNRAGRLAVRAST
KRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWA
LTEAFLPSAEAELIFIEGSPDYCNRNASLSIQGTEGRECLQNARSASRREQRSCGRLCTE
CGLQVEERRTEAVSSCDCNFQWCCTVKCGQCRRVVSRYYCTRPASSAKPRGRGKDSAW
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggcaggaccatgggacacttgttaatgctgtgggtggctgcgggcatgtgctatccc
gccctcggtgcttctgcctggtcagtgaacaacttcctgatatcgggtcccaaggcctat
ctgacctacaccgccagtgtggccttgggcgctcagattggcatcgaagagtgtaagttc
cagtttgcctgggagcggtggaactgtcctgagcatgcctttcagttttcagcccacaac
aggctgcgagctgccacgagagagacatccttcattcatgccatccgctctgctgccatc
atgtacgcagtcaccaagaactgcagcatgggtgacttggaaaactgcggctgtgacgag
tcacaaaatggaaaaacaggtggccatggctggatctggggaggctgcagcgacaacgtg
gaattcggagaaaagatctccaggctcttcgtggatggtttggagaaagggaaggacact
agagccctggtgaaccttcacaacaacagggccggcaggctggcagtgagggcctccacg
aaaaggacctgcaagtgtcatggcatctcaggaagctgcagcatccagacgtgttggctg
cagctggctgacttcaggcagatgggaaattacctaaaagccaagtatgaccgcgcgctg
aagattgagatggataagcgccagctaagggctggcaacagagccgagggccgctgggct
ctcacggaggccttccttcccagcgcagaggccgagctgatcttcatagaggggtctcct
gactactgcaaccgcaatgccagcctgagcatccagggcacagaggggcgggagtgcctg
cagaatgcccgcagtgcttcccggcgggagcagcgcagctgtgggcgcctgtgcacagag
tgcgggctgcaggtggaggagaggagaacagaggccgtgagcagctgcgactgcaacttt
cagtggtgttgcactgtcaagtgtggccagtgcagacgtgtggtgagcagatactactgc
acacgccctgcaagtagtgccaagcctcggggcaggggcaaggacagtgcctggtaa

KEGG   Mus pahari (shrew mouse): 110335001
Entry
110335001         CDS       T05929                                 

Gene name
Wnt7b
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110335001 (Wnt7b)
   04390 Hippo signaling pathway
    110335001 (Wnt7b)
   04150 mTOR signaling pathway
    110335001 (Wnt7b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110335001 (Wnt7b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110335001 (Wnt7b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335001 (Wnt7b)
   05205 Proteoglycans in cancer
    110335001 (Wnt7b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110335001 (Wnt7b)
   05226 Gastric cancer
    110335001 (Wnt7b)
   05217 Basal cell carcinoma
    110335001 (Wnt7b)
   05224 Breast cancer
    110335001 (Wnt7b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110335001 (Wnt7b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110335001 (Wnt7b)
   05022 Pathways of neurodegeneration - multiple diseases
    110335001 (Wnt7b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110335001 (Wnt7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110335001 (Wnt7b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110335001 (Wnt7b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110335001
NCBI-ProteinID: XP_021072736
Ensembl: MGP_PahariEiJ_G0020133
LinkDB
Position
17
AA seq 353 aa
MLLLSPRSALVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctcctgtcgccgcgcagcgcgctggtctccgtctattgcccgcagatctttctc
cttctgtccagcggcagctacctagcattgtcatccgtggtggccctgggagccaacatc
atctgcaacaagattcctggcctggccccacggcagcgtgccatctgccagagccgaccc
gatgccatcattgtgatcggggagggggcgcagatgggcatcgacgagtgccagcaccag
ttccgattcggccgctggaactgctcggccctgggcgagaagaccgtcttcgggcaagaa
ctccgagtagggagtcgagaggctgccttcacatatgccatcaccgcggcgggtgtggca
cacgccgtcaccgccgcctgcagccagggcaatctgagtaattgtggctgtgaccgggag
aagcaaggctactacaaccaggcagaaggctggaagtgggggggctgctcagctgacgtc
cgctacggcatcgacttttctcggcgctttgtggatgcccgcgagatcaaaaagaacgcc
aggcgcctcatgaaccttcacaacaatgaggcgggcagaaaggttctggaggaccgcatg
aagctggaatgtaagtgtcacggtgtgtcaggctcctgtaccaccaaaacctgctggacc
acactgcccaagtttcgcgaagtgggccacctgctcaaggagaaatacaacgcagccgtg
caggtagaggtggtgcgagccagccgcctgcgccagcccaccttcctgcgcatcaagcaa
ctgcgcagctaccagaagcctatggagacggacctggtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccacgggcagcgtgggcacgcagggccgtctgtgcaaccgc
acctcaccgggggccgacggctgtgacaccatgtgctgcggccgcggctacaacacgcac
cagtacaccaaggtgtggcagtgcaactgcaaattccactggtgttgcttcgtcaagtgc
aacacgtgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Mus pahari (shrew mouse): 110335137
Entry
110335137         CDS       T05929                                 

Gene name
Wnt10b
Definition
(RefSeq) protein Wnt-10b isoform X1
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110335137 (Wnt10b)
   04390 Hippo signaling pathway
    110335137 (Wnt10b)
   04150 mTOR signaling pathway
    110335137 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110335137 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110335137 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335137 (Wnt10b)
   05205 Proteoglycans in cancer
    110335137 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110335137 (Wnt10b)
   05226 Gastric cancer
    110335137 (Wnt10b)
   05217 Basal cell carcinoma
    110335137 (Wnt10b)
   05224 Breast cancer
    110335137 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110335137 (Wnt10b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110335137 (Wnt10b)
   05022 Pathways of neurodegeneration - multiple diseases
    110335137 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110335137 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110335137 (Wnt10b)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110335137 (Wnt10b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110335137
NCBI-ProteinID: XP_021072859
Ensembl: MGP_PahariEiJ_G0020248
LinkDB
Position
17
AA seq 389 aa
MLEEPRSRPPPLGLAGLLFLALFSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSP
VPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPALGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggtctcggcctccgcccttaggcctcgcgggtctcctgttcttg
gctttgttcagtcgggctctaagcaatgagattctgggccttaaacttcccggtgagccg
ccgctgacggccaacaccgtgtgcttgaccctgtccggactgagtaagcgacagctgggg
ctgtgcctgcgcagccccgacgtgacggcgtcggcgctccaggggctgcacatcgccgtt
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcgctggagggcggc
ggccggctgccgcaccacagcgccatcctcaagcgcggtttccgagagagtgcattctcc
ttctccatgctggctgcaggggtcatgcatgcagttgccacagcctgcagcctgggcaag
ctggtgagctgcggctgcggctggaagggtagtggtgagcaggaccgacttcgggccaag
ctgctgcagcttcaggcactgtctcggggcaagactttccccatctcccagcccagccct
gttcctggctcagtccccagcccaggcccccaggacacgtgggaatggggtggctgtaac
cacgacatggactttggagagaagttctcccgggatttcttggattccagggaagctccc
cgggatatccaggcgagaatgcggatccacaacaacagggtgggacgccaggtggtaaca
gaaaacctgaagcggaagtgcaaatgccatggaacgtcaggcagctgccaattcaagacc
tgttggagggcagcgccagagttccgggccatcggggcagcactgagggagaggctgagc
agagccatcttcatcgatacccacaaccgcaactctggagcgttccagccccgcctacgt
ccacggcgcctctcaggagagctggtttacttcgagaagtctcctgacttctgtgagcga
gaccctgctttgggttccccaggcacgagaggccgggcttgcaacaagaccagccgcctc
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtcctccggcagacgcga
gtggagcgctgtcactgtcgtttccactggtgctgttatgtgctgtgtgatgagtgtaaa
gtcacggagtgggtcaatgtgtgtaagtga

KEGG   Mus pahari (shrew mouse): 110335204
Entry
110335204         CDS       T05929                                 

Gene name
Wnt1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110335204 (Wnt1)
   04390 Hippo signaling pathway
    110335204 (Wnt1)
   04150 mTOR signaling pathway
    110335204 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110335204 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110335204 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335204 (Wnt1)
   05205 Proteoglycans in cancer
    110335204 (Wnt1)
   05207 Chemical carcinogenesis - receptor activation
    110335204 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110335204 (Wnt1)
   05226 Gastric cancer
    110335204 (Wnt1)
   05217 Basal cell carcinoma
    110335204 (Wnt1)
   05224 Breast cancer
    110335204 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110335204 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110335204 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    110335204 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110335204 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110335204 (Wnt1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110335204 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 110335204
NCBI-ProteinID: XP_021072924
Ensembl: MGP_PahariEiJ_G0020249
LinkDB
Position
17
AA seq 370 aa
MGFWALLPSWFSATLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggttctgggcgctgctgcccagctggttttctgctacgttgctactggcactgacc
gctctgcccgcagccctggccgccaacagtagtggccgatggtggggcatcgtgaacatt
gcctcctccacgaacctgctgacggattccaagagtctgcagctggtgctcgagcccagt
ctgcagctgctgagccgcaagcagcggcgactgatccgacagaacccggggatcctgcac
agcgtgagtggagggctgcagagcgccgtgcgagagtgcaagtggcaattccgaaaccgc
cgctggaactgccccactgctcccgggccccacctcttcggcaagatcgttaaccgaggc
tgccgagaaacagcgttcatcttcgcaatcacctccgctggggtcacacattcggtggcg
cgctcctgctccgaaggctccatcgagtcgtgcacctgcgactaccggaggcgtggccct
gggggccccgactggcactgggggggctgcagcgacaacatcgatttcggtcgcctcttc
ggccgagagttcgtggactctggggagaaggggcgggacctacgcttcctcatgaacctt
cacaacaacgaggcagggcgcacgaccgtgttctctgagatgcgccaagagtgcaaatgc
catgggatgtccggctcctgcacggtgcgcacgtgttggatgcggctgcccacgctgcgc
gctgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcccgcgtcctttacggcaac
cgaggaagcaaccgcgcctcgcgggcggagctgctgcgcctggagcccgaagaccctgcg
cacaagcctccctcccctcatgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagtggccgcctgggcacagctggcacagctgggcgagcttgcaacagctcgtctccc
gcgctggacggctgcgagctgctgtgctgtggccgaggccaccgcacgcgcacgcagcgc
gtcacggagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctatga

DBGET integrated database retrieval system