KEGG   Mus pahari (shrew mouse): 110316798
Entry
110316798         CDS       T05929                                 
Symbol
Cntnap2
Name
(RefSeq) contactin-associated protein-like 2
  KO
K07380  contactin associated protein-like 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110316798 (Cntnap2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110316798 (Cntnap2)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   110316798 (Cntnap2)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF Laminin_G_3 COLFI hEGF
Other DBs
NCBI-GeneID: 110316798
NCBI-ProteinID: XP_021046868
LinkDB
Position
2:63971066..66073259
AA seq 734 aa
MQSYTELRPGKENKEKCDEPLISALPHVSFSSSSSLSSSYAPGYAKINKRGGAGGWSPSD
SDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPG
NVNSDSVVRHDLQHAVVARYIRIVPLDWNGEGHIGLRAEVYGCAYWADVINFDGHGVLPY
RFRNKKMKTLKDVIALKFKTSESEGVLLHGEGQQGDYITLELKKAKLVLSLNLGSNQLGP
IYGHTSVTSGSLLDDHHWHSVLIERQGRSINLTLDRSMQHFRTNGEFDYLDLDYEITFGG
IPFSGKPSSSNRKNFKGCMESINYNGVNITDLARRKKLEPSNMGNLSFSCVEPYTVPVFF
NATSYLEVPGRLNQDLFSVSFQFRTWNPSGLLLFSHFADNLGNVEIDLVESKVGVHINNT
QTKTSQIDISSGSGLNDGQWHEVRFLAKENFAVLTIDGDEASAVRTNSPLQVKTGEKYFF
GGFLNHMSNASYSALQPSFQGCMQLIQVDDQLVNLYEVAQRKPGSFANVTIDMCAIIDRC
VPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCEAYKHLGQTSNYYWIDPDG
SGPLGPLKVYCNMTEDKVWTIVSHDLQMQTTVVGYNPEKYSVTQLIYSASMDQISAITSS
AEYCEQYVSYFCRMSRLLNTPDGSPYTWWVGKANEKHYYWGGSEPGIQKCACGIERNCTD
PKYYCNCDADYKQW
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgcaaagctacactgagctcagacctgggaaagaaaataaggaaaaatgtgatgagcct
ctcatctctgctcttccccatgtgtccttcagcagctcttcctccctgtccagcagctat
gcacctggctatgccaagattaataaacgaggaggtgctggaggatggtctccatcagac
agtgaccactatcaatggcttcaggttgattttggcaatcgtaagcagatcagtgccatt
gcaacccaaggaaggtacagcagttctgattgggtgacacaatatcgaatgctctacagt
gacacagggagaaactggaaaccctatcatcaagatggcaatatctgggcttttccaggc
aacgtcaattctgacagtgtggtgcgacacgacctgcagcatgcagtagttgcccgttac
atacgcattgtgcccctggactggaacggagaaggccacatagggctgcgtgctgaagtc
tatggctgcgcctactgggccgacgttatcaactttgatggccatggtgtgttaccatat
cgattcagaaacaagaagatgaaaacactcaaagatgttattgctttgaaatttaagacc
tctgaaagtgaaggagtacttttgcatggtgaaggacagcaaggggattacattactttg
gaactgaaaaaagcaaagctggtcctcagtttaaatctaggaagcaaccagcttggcccc
atctatggccacacatctgtgacatctgggagcttgctggatgatcaccactggcactct
gtactcattgagcgccagggacgcagcattaacctaaccctggacaggagcatgcagcat
tttcgcaccaatggagagtttgactacctggacttggactatgagataacatttggaggc
atacctttctctggtaagccaagttccagtaataggaagaactttaagggctgcatggaa
agcatcaactacaatggtgtcaatattaccgatcttgcccgaagaaagaaattagaacca
tcgaatatggggaatctgagtttctcttgtgtggagccctatacagtaccagtcttcttc
aatgctacaagttacctggaggtacctggcaggcttaatcaggacctgttctcagtcagt
ttccagtttaggacttggaaccccagcggtctcttgctcttcagtcactttgcagataac
ttgggcaatgtggagattgaccttgtggagagcaaagtgggcgtccacataaacaacaca
cagaccaagacaagccaaattgacatctcctcaggctctggactgaatgatgggcaatgg
catgaggttcgcttcctggccaaggaaaacttcgcagtcctcaccattgatggagatgag
gcatcagcagttcgaaccaatagtcctcttcaagtgaagactggcgagaaatacttcttt
ggaggatttctgaaccacatgagcaatgccagctactctgcccttcagccatcattccag
ggatgtatgcagctcattcaggtagatgaccagcttgtgaatttatacgaagtagcacag
aggaagccaggaagctttgcaaatgtcaccattgatatgtgcgccatcatagacagatgt
gtgcccaatcactgtgagcatggtgggaagtgctcgcaaacatgggacagcttcaaatgc
acttgtgatgagacagggtacagcggggccacctgccacaactccatctacgagccctcc
tgtgaagcatacaaacaccttggccagacatcaaattactactggatagatcctgatggc
agtggaccactggggcctctgaaggtttattgcaacatgacagaggacaaggtgtggacc
atagtgtctcatgacttacagatgcagacgacagtggtaggctacaacccagaaaagtac
tctgtgacacagctcatctacagtgcctccatggaccagatcagtgccatcaccagcagc
gctgagtactgcgaacagtatgtctcctacttctgcaggatgtccaggttgttgaacacc
ccagatggaagtccttacacctggtgggttggcaaagccaatgagaagcactactactgg
ggaggatcagagcctggaattcagaagtgtgcctgcggtattgagcgcaactgcacagat
cccaagtactactgcaactgtgatgcagactacaagcagtggtga

DBGET integrated database retrieval system