KEGG   Mus pahari (shrew mouse): 110316834
Entry
110316834         CDS       T05929                                 
Symbol
Cd8b
Name
(RefSeq) T-cell surface glycoprotein CD8 beta chain
  KO
K06459  T-cell surface glycoprotein CD8 beta chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04660  T cell receptor signaling pathway
mpah05135  Yersinia infection
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110316834 (Cd8b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110316834 (Cd8b)
   04612 Antigen processing and presentation
    110316834 (Cd8b)
   04660 T cell receptor signaling pathway
    110316834 (Cd8b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110316834 (Cd8b)
  09163 Immune disease
   05340 Primary immunodeficiency
    110316834 (Cd8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110316834 (Cd8b)
CD molecules [BR:mpah04090]
 Proteins
  110316834 (Cd8b)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 GET4
Other DBs
NCBI-GeneID: 110316834
NCBI-ProteinID: XP_021046883
Ensembl: MGP_PahariEiJ_G0022220
LinkDB
Position
2:89255795..89270513
AA seq 177 aa
MQPWLWLVFSMKLAALWSSSALIQTPSSLLVQTNHMAKMSCEDKSVSKLTSIYWLREHQD
PTKDKYFEFLASWSSSKGVLYGEGMNKKNISLSSESSRPFLSIMNVKPEDSGFYFCAMVG
SPKLVFGTGTKLTVGLTCSIITVGLLVACILVLLVSLGLAIHFYCVRRRARIRFMKQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcagccatggctctggctggtcttcagtatgaagctggcagctctctggagcagttct
gccctcattcagaccccttcatccctgctggttcaaaccaaccatatggcaaagatgtcc
tgtgaggataaaagcgtctctaagttaacaagcatctactggctgcgggagcaccaggac
cccaccaaggataagtactttgagttcctggcctcctggagttcttccaaaggagttttg
tatggtgaagggatgaacaagaagaatataagtctgtcttcagaatcaagccggcccttt
ctcagtatcatgaatgtgaagccagaggacagcggcttctacttctgcgcgatggttggg
agccccaagttggtctttgggacagggacgaagctgactgtgggcctgacatgcagcatc
attactgtcggcctgctggtggcctgcatcctggttctgctggtatcccttggattggcc
atccacttttactgtgtgcggaggagagcccgaattcgcttcatgaaacagtaa

KEGG   Mus pahari (shrew mouse): 110317311
Entry
110317311         CDS       T05929                                 
Symbol
Cd8a
Name
(RefSeq) T-cell surface glycoprotein CD8 alpha chain
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04660  T cell receptor signaling pathway
mpah05135  Yersinia infection
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110317311 (Cd8a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317311 (Cd8a)
   04612 Antigen processing and presentation
    110317311 (Cd8a)
   04660 T cell receptor signaling pathway
    110317311 (Cd8a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110317311 (Cd8a)
  09163 Immune disease
   05340 Primary immunodeficiency
    110317311 (Cd8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110317311 (Cd8a)
CD molecules [BR:mpah04090]
 Proteins
  110317311 (Cd8a)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set AEP1 GATase_2 Ig_4 Ig_5 PRIMA1
Other DBs
NCBI-GeneID: 110317311
NCBI-ProteinID: XP_021047400
Ensembl: MGP_PahariEiJ_G0022221
LinkDB
Position
2:89306783..89310179
AA seq 249 aa
MASLLTCFLSLNLLLLGELMIPGRAGAGAHQGSGQFIISPKKMDAELGQKVELVCEVVWS
TSQGCSWLFQNSSSKLPQPIFVVYIASSHSKITLNDELDPKLFSAKRDMNKYILTLNKFS
KETEGYYFCSVTSNSMMYFSSLVPVFQKVKSTTTKPVLRTTTPVPPTGTSRPPRPETCRP
GAGGSVEATGLDFACDIYIWAPLAGFCGVLLLSLITTLICYHRIRKRVCKCPRPLVRQEG
KPRPSEKLV
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcctcactgttgacctgctttctgtccctgaatctgctactgctgggtgagttgatg
atcccggggagggcaggggctggagcacatcaaggttctggacagttcataatctcgcca
aagaaaatggacgccgaactgggccagaaggtggagctggtatgcgaagtggtgtggtcc
acttcccaaggatgctcttggctcttccagaactccagctccaaactcccccagcccatc
tttgtcgtctatatagcttcatcccactccaagataacgctgaacgatgagctggatccg
aaactgttttctgccaagagggacatgaacaagtacatcctcaccctgaacaagttcagc
aaggaaactgaaggctactatttctgctcagtcactagcaactcgatgatgtacttcagc
tctctcgtgccggtctttcagaaagtgaagtctactaccaccaaaccagtgctgcgaact
accacaccagtgccccctaccgggacatctcggcccccgagaccagaaacttgccggccc
ggggcgggtggctcagtggaggcgacgggattggatttcgcctgtgatatttacatctgg
gcacccttggccggattctgcggggtccttctgctgtccttgatcaccactctcatctgc
taccacaggatccgaaagcgggtttgcaaatgccccaggccgctagtcagacaggaaggc
aagccccgaccttcagagaaattagtgtaa

DBGET integrated database retrieval system