KEGG   Mus pahari (shrew mouse): 110316879
Entry
110316879         CDS       T05929                                 

Symbol
Mitf
Name
(RefSeq) microphthalmia-associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04137  Mitophagy - animal
mpah04380  Osteoclast differentiation
mpah04916  Melanogenesis
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05218  Melanoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110316879 (Mitf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110316879 (Mitf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110316879 (Mitf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316879 (Mitf)
   05202 Transcriptional misregulation in cancer
    110316879 (Mitf)
  09162 Cancer: specific types
   05218 Melanoma
    110316879 (Mitf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110316879 (Mitf)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    110316879 (Mitf)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Other DBs
NCBI-GeneID: 110316879
NCBI-ProteinID: XP_021046899
Ensembl: MGP_PahariEiJ_G0022432
LinkDB
Position
2
AA seq 501 aa
MQSESGIVADFEVGEEFHEEPKTYYELKSQPLKSSSSAEHSGASKPPLSSSTMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVAVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRHQVKQYLSTTLANKHASQVLSSPCPNQPGDHAMPPVPGSSAPNS
PMAMLTLNSNCEKEAFYKFEEQSRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTVERRRRF
NINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKDLENRQKKLEHAN
RHLLLRVQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQELVQHPADLTCT
TTLDLTDGTINFTNNLGTMPESSPAYSIPRKMGSNLEDILMDDALSPVGVTDPLLSSVSP
GASKASSRRSSMSAEETEHAC
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgcagtccgaatcgggaatcgtggcggattttgaagtcggggaggagtttcacgaagaa
cccaaaacctattacgaactcaaaagtcaacctctgaagagcagcagttctgcagagcat
tctggggcctccaagcctccgttaagctcctccactatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcagcccagttcatgcaacagagagtggccgtgagtcagacaccagccataaacgtc
agcgtgcccaccacccttccctctgccacccaggtgccgatggaagtccttaaggtgcag
acccacctggaaaaccccaccaagtaccacatacagcaagcccaaaggcaccaggtaaag
cagtacctttctaccactttagcaaataaacatgccagccaagtcctgagctcgccatgt
ccaaaccagcctggcgaccatgccatgccaccagtgccggggagcagcgcacccaacagc
cctatggctatgctcactcttaactccaactgtgaaaaagaggcattttataagtttgag
gagcagagcagggcagagagtgagtgcccaggtatgaacacgcactctcgagcatcgtgc
atgcagatggatgatgtaattgatgacatcatcagcctggaatcaagttataatgaagaa
attttgggcttgatggatccagccttgcaaatggcaaatacgttgcctgtctctggaaac
ttgatcgacctctacagcaaccagggcctgccgcccccaggccttaccatcagcaactcc
tgtccagccaatcttcccaacatcaaaagggagctcacagttgaacgaagaagaagattt
aacataaacgaccgcattaaggagctaggtactttgatccccaagtcaaatgatccagac
atgcggtggaacaagggaaccattctcaaggcctctgtggactacatccggaagttgcaa
cgggaacagcaacgagctaaggaccttgaaaaccgacagaagaagctggagcatgctaac
cggcacctgctgctccgagtacaggagctggagatgcaggctagagcgcatggactttcc
cttatcccatccaccggcctctgctcgcctgatctggtgaatcggatcatcaagcaagaa
ccagttcttgagaactgcagccaggaacttgtacagcacccggcagacctgacgtgtacg
acgactctggatctcacggatggtaccatcaactttaccaacaacctcggcaccatgccg
gagagcagcccggcctacagcatccccaggaagatgggctcaaacttggaagacatcctg
atggacgatgccctctcacctgttggcgtcaccgacccactgctgtcatcagtgtcgcca
ggagcttcaaaagcaagtagccgcaggagcagtatgagcgcagaagaaacggagcatgcg
tgttag

DBGET integrated database retrieval system