KEGG   Mus pahari (shrew mouse): 110317065
Entry
110317065         CDS       T05929                                 
Symbol
Nod1
Name
(RefSeq) nucleotide-binding oligomerization domain-containing protein 1
  KO
K08727  nucleotide-binding oligomerization domain-containing protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah05132  Salmonella infection
mpah05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110317065 (Nod1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110317065 (Nod1)
   05133 Pertussis
    110317065 (Nod1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mpah04054]
    110317065 (Nod1)
Pattern recognition receptors [BR:mpah04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110317065 (Nod1)
SSDB
Motif
Pfam: NACHT LRR_6 CARD NLRC4_HD2 LRR_4 NOD2_WH RsgA_GTPase AAA_16 Mg_chelatase Sigma54_CBD AAA_22 AAA_25 ABC_tran AAA_18
Other DBs
NCBI-GeneID: 110317065
NCBI-ProteinID: XP_021047080
Ensembl: MGP_PahariEiJ_G0022158
LinkDB
Position
2:complement(73537302..73586509)
AA seq 952 aa
MEERGHHEMEGTPSGCHSHIKLLKINREHLVPNIRNTQCLVDNLLENGYFSAEDAEIVCA
CPTKPDKVRKILDLVQSKGEEVSEFFLYVLQQLEDAYVDLRLWLSEIGFSPSQLIRTKTI
VNTDPVSRYTQQLRHQLGRDSKFMLCYAQKEDLLLEEIYMDTLMELVGFNNENLGSLGGL
DCLLDHSTGVLNEHGETVFMFGDAGVGKSMLLQRLQSLWASGRLTPTAKFFFHFRCRMFS
CFKESDMLTLQDLLFKHFCYPEQDPEEVFSFLLRFPHTALFTFDGLDELHSDFDLSRVPD
NCCPWEPAHPLVLLANLLSGRMLKGAGKLLTARTGVEVPRQLLRKKVLLRGFSPNHLRTY
ARRMFPERTAQEHLLQQLDANPNLCSLCGVPLFCWIIFRCFQHFHTAFEGSSQLPDCAVT
LTDVFLLVTEVHLNRTQPSSLVQRNTRSPAETLRAGWRTLHALGEVAHRGTDRSLFVFGQ
EEVQASKLQEGDLQLGFLRALPDVGPEQGQSYEFFHLTLQAFFTAFFLVADDKVSTRELL
RFFREWTSPGEATSSSCHPSFFSFQCLGGRSRLGPDPFRNKDHFQFTNLFLCGLLAKARQ
KLLRQLVPKAVLRRKRKALWAHLFASLRSYLKSLPRVQSGGFNQVHAMPTFLWMLRCIYE
TQSQKVGRLAARGISADYLKLAFCNACSADCSALSFVLHHFHRQLALDLDNNNLNDYGVQ
ELQPCFSRLTVIRLSVNQITDTGVKVLCEELTKYKIVTFLGLYNNQITDIGARYVAQILD
ECKGLTHLKLGKNRITSEGGKCVALAVKNSTSIVDVGMWGNQIGDEGAKAFAEALRDHPS
LTTLSLAFNGISPEGGKSLAQALKQNTTLTIIWLTKNELNDEAAECFAEMLRVNQTLQHL
WLIQNRITAKGTAQLARALQKNTAITEICLNGNLIKPEEAKVFENEKRIICF
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggaggagcgcggccatcatgagatggaaggcaccccatcgggctgtcactcccacatt
aaactgctgaagatcaacagggaacatctggtccccaacattcggaacactcagtgtctg
gtggacaacctgctggagaatggctacttctcagccgaagatgcagagattgtgtgtgcc
tgtcccaccaagcctgacaaggtccgaaagatccttgacctggtgcagagcaaaggcgag
gaggtgtctgagttcttcctctacgtgctgcagcagctggaggatgcttacgtggacctc
aggctgtggctctcagagattggcttctccccttcccagctcattcggaccaaaactatc
gtcaatactgacccagtaagcaggtatacccaacagctgcgacaccaactgggccgcgac
tccaagttcatgctgtgctacgcccaaaaggaggacctgctgctggaggagatctatatg
gacacactcatggagctggtaggcttcaacaatgaaaacctgggcagcctaggaggcctg
gattgcctgctggaccacagcacgggggtcctcaatgagcatggagagactgtcttcatg
tttggggacgcgggagtgggcaagtccatgctgctgcagaggttgcagagcctctgggcg
tcgggcaggttgaccccgacggccaaattcttcttccacttccgctgccgcatgttcagc
tgcttcaaggagagcgacatgctgactctgcaggacttgctcttcaagcatttctgctac
ccggagcaggacccagaggaggtgttctcctttttgctgcgctttccccacacggcgctc
ttcactttcgacggcctagatgagctgcactcagacttcgacctgagccgcgtgccagat
aactgctgcccatgggagccggctcaccctctggtcctgctggctaacctcctaagcggg
aggatgctcaagggtgcgggcaaactgctcacggctcgcacaggtgtggaggtcccccgc
cagctcctgcgcaaaaaggtgctgctccggggcttctccccgaaccacctgcgcacctat
gcccgcaggatgttccccgagcgcacggcgcaggagcatctgctgcagcagctcgatgcc
aaccccaacctctgcagcctgtgcggggtgccgctcttctgctggatcatcttccgttgc
tttcagcacttccacacggccttcgagggctcctcgcagttgccggactgtgctgtgacc
ctgactgatgtctttctgctggtcactgaggtgcatctgaacaggacgcaacccagcagc
ctggtgcagcgcaacacgcgcagcccggcggaaaccctacgtgcaggctggcgcacgctg
catgcgctgggcgaggtggctcatcgaggcacggacaggagcctctttgtgtttggccag
gaggaggtgcaggcgtcgaagctgcaggaaggagatctgcagctgggcttcctgcgggct
ttgcccgatgtgggccctgagcagggccagtcttacgaatttttccaccttacgctccag
gccttcttcaccgccttcttcctggtagcagatgacaaagtgagcacccgggagttgcta
aggttctttcgagaatggacgtctccaggggaggcaacaagctcgtcctgccatccttcc
ttcttctccttccagtgcctgggtggcagaagccggttgggccctgatcctttcaggaac
aaagatcacttccagttcaccaacctcttcctgtgtgggctgctggccaaagcccgacag
aaactccttcggcagctcgtgcccaaggctgtcctaaggaggaagcgcaaggccctgtgg
gctcacctgtttgccagcctgcgctcctacttgaagagcctaccgcgggtccagtctgga
ggctttaaccaggtgcatgccatgcctacattcctgtggatgctgcgctgcatctatgag
acgcagagccagaaggtggggcgcctcgccgccaggggcatcagtgcggactacctcaag
ctggccttctgcaacgcttgctctgcggactgcagcgccctgtccttcgtcctgcatcac
ttccacaggcagctggccctagacctggacaacaacaacctcaatgactatggagtacag
gagctgcagccttgctttagccgtctcacggttatcagactcagcgtcaaccagatcacc
gacaccggggtgaaggtgctgtgtgaggaactgaccaagtacaagatcgtgacgttcctg
ggtttatacaacaaccagatcactgatatcggagccaggtatgtggcccaaatcctggat
gaatgcaaaggcctcacacaccttaaactagggaaaaacagaataacaagtgagggcggg
aagtgcgtggctttggctgtgaagaacagcacctccatcgttgatgtcgggatgtggggc
aatcagattggagacgaaggggcaaaggccttcgcagaggccttgagggatcaccccagc
ctgaccactctcagtcttgcattcaatggcatctccccggagggagggaagagccttgca
caggccctgaagcagaacaccacgctgacaataatctggctgaccaagaatgaacttaat
gatgaggccgcagagtgctttgccgagatgctgcgggtgaaccagacgctacagcattta
tggctgatccagaatcgtatcacagccaaggggacagcgcagctggccagggctctgcag
aagaacactgccataacagagatttgtctcaacggaaacttaattaagcctgaggaggcc
aaagtctttgaaaatgagaagaggatcatctgtttctga

DBGET integrated database retrieval system