KEGG   Mus pahari (shrew mouse): 110317258
Entry
110317258         CDS       T05929                                 

Gene name
Akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110317258 (Akt2)
   04012 ErbB signaling pathway
    110317258 (Akt2)
   04014 Ras signaling pathway
    110317258 (Akt2)
   04015 Rap1 signaling pathway
    110317258 (Akt2)
   04370 VEGF signaling pathway
    110317258 (Akt2)
   04371 Apelin signaling pathway
    110317258 (Akt2)
   04630 JAK-STAT signaling pathway
    110317258 (Akt2)
   04668 TNF signaling pathway
    110317258 (Akt2)
   04066 HIF-1 signaling pathway
    110317258 (Akt2)
   04068 FoxO signaling pathway
    110317258 (Akt2)
   04072 Phospholipase D signaling pathway
    110317258 (Akt2)
   04071 Sphingolipid signaling pathway
    110317258 (Akt2)
   04024 cAMP signaling pathway
    110317258 (Akt2)
   04022 cGMP-PKG signaling pathway
    110317258 (Akt2)
   04151 PI3K-Akt signaling pathway
    110317258 (Akt2)
   04152 AMPK signaling pathway
    110317258 (Akt2)
   04150 mTOR signaling pathway
    110317258 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110317258 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    110317258 (Akt2)
   04218 Cellular senescence
    110317258 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110317258 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110317258 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317258 (Akt2)
   04613 Neutrophil extracellular trap formation
    110317258 (Akt2)
   04620 Toll-like receptor signaling pathway
    110317258 (Akt2)
   04625 C-type lectin receptor signaling pathway
    110317258 (Akt2)
   04660 T cell receptor signaling pathway
    110317258 (Akt2)
   04662 B cell receptor signaling pathway
    110317258 (Akt2)
   04664 Fc epsilon RI signaling pathway
    110317258 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    110317258 (Akt2)
   04062 Chemokine signaling pathway
    110317258 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110317258 (Akt2)
   04922 Glucagon signaling pathway
    110317258 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    110317258 (Akt2)
   04920 Adipocytokine signaling pathway
    110317258 (Akt2)
   04929 GnRH secretion
    110317258 (Akt2)
   04915 Estrogen signaling pathway
    110317258 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    110317258 (Akt2)
   04917 Prolactin signaling pathway
    110317258 (Akt2)
   04926 Relaxin signaling pathway
    110317258 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    110317258 (Akt2)
   04919 Thyroid hormone signaling pathway
    110317258 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110317258 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110317258 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    110317258 (Akt2)
   04728 Dopaminergic synapse
    110317258 (Akt2)
   04722 Neurotrophin signaling pathway
    110317258 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110317258 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    110317258 (Akt2)
   04213 Longevity regulating pathway - multiple species
    110317258 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317258 (Akt2)
   05205 Proteoglycans in cancer
    110317258 (Akt2)
   05207 Chemical carcinogenesis - receptor activation
    110317258 (Akt2)
   05208 Chemical carcinogenesis - reactive oxygen species
    110317258 (Akt2)
   05230 Central carbon metabolism in cancer
    110317258 (Akt2)
   05231 Choline metabolism in cancer
    110317258 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110317258 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110317258 (Akt2)
   05212 Pancreatic cancer
    110317258 (Akt2)
   05225 Hepatocellular carcinoma
    110317258 (Akt2)
   05226 Gastric cancer
    110317258 (Akt2)
   05214 Glioma
    110317258 (Akt2)
   05221 Acute myeloid leukemia
    110317258 (Akt2)
   05220 Chronic myeloid leukemia
    110317258 (Akt2)
   05218 Melanoma
    110317258 (Akt2)
   05211 Renal cell carcinoma
    110317258 (Akt2)
   05215 Prostate cancer
    110317258 (Akt2)
   05213 Endometrial cancer
    110317258 (Akt2)
   05224 Breast cancer
    110317258 (Akt2)
   05222 Small cell lung cancer
    110317258 (Akt2)
   05223 Non-small cell lung cancer
    110317258 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110317258 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    110317258 (Akt2)
   05161 Hepatitis B
    110317258 (Akt2)
   05160 Hepatitis C
    110317258 (Akt2)
   05164 Influenza A
    110317258 (Akt2)
   05162 Measles
    110317258 (Akt2)
   05168 Herpes simplex virus 1 infection
    110317258 (Akt2)
   05163 Human cytomegalovirus infection
    110317258 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110317258 (Akt2)
   05169 Epstein-Barr virus infection
    110317258 (Akt2)
   05165 Human papillomavirus infection
    110317258 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110317258 (Akt2)
   05135 Yersinia infection
    110317258 (Akt2)
   05152 Tuberculosis
    110317258 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110317258 (Akt2)
   05142 Chagas disease
    110317258 (Akt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317258 (Akt2)
   05017 Spinocerebellar ataxia
    110317258 (Akt2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110317258 (Akt2)
   05418 Fluid shear stress and atherosclerosis
    110317258 (Akt2)
   05415 Diabetic cardiomyopathy
    110317258 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317258 (Akt2)
   04931 Insulin resistance
    110317258 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110317258 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110317258 (Akt2)
   01524 Platinum drug resistance
    110317258 (Akt2)
   01522 Endocrine resistance
    110317258 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110317258 (Akt2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110317258 (Akt2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110317258 (Akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1
Other DBs
NCBI-GeneID: 110317258
NCBI-ProteinID: XP_021047351
Ensembl: MGP_PahariEiJ_G0012656
LinkDB
Position
1
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDAM
DYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtatctgtcatcaaagaaggctggctccacaaacgtggtgaatacatcaaa
acctggaggccccggtacttccttctgaagagtgatggatctttcattgggtataaggag
aggcccgaggcccctgaccagacattaccccccctgaacaatttctctgtagcagaatgt
cagctgatgaagactgagaggccacgacccaacacctttgtcatacgctgcctacagtgg
accacagtcatagagaggaccttccatgtagactctccagatgagagggaagagtggatg
cgggctatccagatggtcgccaatagtctgaagcagcggggcccaggtgaagacgccatg
gattacaagtgtggctcccccagtgactcttccacatctgagatgatggaggtagctgtc
aacaaggcacgggccaaagtgaccatgaatgacttcgattatctcaaactcctcggcaag
ggcaccttcggcaaagtcattctggttcgagagaaggccactggtcgctattatgccatg
aagatcctgcggaaggaggtcatcattgcaaaggatgaagtcgcccacacagtcacagag
agtcgcgttctgcagaataccaggcaccccttccttacagccctcaagtatgccttccag
acccatgaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgtttttccac
ctctctcgggagcgggtcttcacggaggaccgggcgcgcttttacggagcggagattgtg
tcagctctggagtatttgcactcaagggatgtggtgtaccgcgacatcaagctggaaaac
cttatgttggacaaagatggccacatcaagatcactgactttggcttgtgcaaagagggc
atcagtgatggagccaccatgaaaaccttctgtggtaccccggagtacttggcgcctgag
gtgctagaagacaatgactacgggcgcgcagtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatccttatggaggagatccgcttcccacgcacgctcgggccagaggctaagtccctg
ctggctgggctgctgaagaaggaccctaagcagaggctcggtggaggtcccagtgatgca
aaggaggtcatggagcatagattcttcctcagcatcaactggcaggatgtggtacagaaa
aagctcctgccacccttcaaacctcaggtcacttcagaagtggacacaaggtacttcgat
gacgaattcaccgcccagtccatcacaatcacacccccagaccgatatgacagcctgggc
tcgctggaactggaccagcggacgcacttcccccagttctcctactcagccagcatccga
gagtga

KEGG   Mus pahari (shrew mouse): 110322284
Entry
110322284         CDS       T05929                                 

Gene name
Akt3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110322284 (Akt3)
   04012 ErbB signaling pathway
    110322284 (Akt3)
   04014 Ras signaling pathway
    110322284 (Akt3)
   04015 Rap1 signaling pathway
    110322284 (Akt3)
   04370 VEGF signaling pathway
    110322284 (Akt3)
   04371 Apelin signaling pathway
    110322284 (Akt3)
   04630 JAK-STAT signaling pathway
    110322284 (Akt3)
   04668 TNF signaling pathway
    110322284 (Akt3)
   04066 HIF-1 signaling pathway
    110322284 (Akt3)
   04068 FoxO signaling pathway
    110322284 (Akt3)
   04072 Phospholipase D signaling pathway
    110322284 (Akt3)
   04071 Sphingolipid signaling pathway
    110322284 (Akt3)
   04024 cAMP signaling pathway
    110322284 (Akt3)
   04022 cGMP-PKG signaling pathway
    110322284 (Akt3)
   04151 PI3K-Akt signaling pathway
    110322284 (Akt3)
   04152 AMPK signaling pathway
    110322284 (Akt3)
   04150 mTOR signaling pathway
    110322284 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110322284 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    110322284 (Akt3)
   04218 Cellular senescence
    110322284 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110322284 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110322284 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110322284 (Akt3)
   04613 Neutrophil extracellular trap formation
    110322284 (Akt3)
   04620 Toll-like receptor signaling pathway
    110322284 (Akt3)
   04625 C-type lectin receptor signaling pathway
    110322284 (Akt3)
   04660 T cell receptor signaling pathway
    110322284 (Akt3)
   04662 B cell receptor signaling pathway
    110322284 (Akt3)
   04664 Fc epsilon RI signaling pathway
    110322284 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    110322284 (Akt3)
   04062 Chemokine signaling pathway
    110322284 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110322284 (Akt3)
   04922 Glucagon signaling pathway
    110322284 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    110322284 (Akt3)
   04920 Adipocytokine signaling pathway
    110322284 (Akt3)
   04929 GnRH secretion
    110322284 (Akt3)
   04915 Estrogen signaling pathway
    110322284 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    110322284 (Akt3)
   04917 Prolactin signaling pathway
    110322284 (Akt3)
   04926 Relaxin signaling pathway
    110322284 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    110322284 (Akt3)
   04919 Thyroid hormone signaling pathway
    110322284 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110322284 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110322284 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    110322284 (Akt3)
   04728 Dopaminergic synapse
    110322284 (Akt3)
   04722 Neurotrophin signaling pathway
    110322284 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110322284 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    110322284 (Akt3)
   04213 Longevity regulating pathway - multiple species
    110322284 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322284 (Akt3)
   05205 Proteoglycans in cancer
    110322284 (Akt3)
   05207 Chemical carcinogenesis - receptor activation
    110322284 (Akt3)
   05208 Chemical carcinogenesis - reactive oxygen species
    110322284 (Akt3)
   05230 Central carbon metabolism in cancer
    110322284 (Akt3)
   05231 Choline metabolism in cancer
    110322284 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322284 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110322284 (Akt3)
   05212 Pancreatic cancer
    110322284 (Akt3)
   05225 Hepatocellular carcinoma
    110322284 (Akt3)
   05226 Gastric cancer
    110322284 (Akt3)
   05214 Glioma
    110322284 (Akt3)
   05221 Acute myeloid leukemia
    110322284 (Akt3)
   05220 Chronic myeloid leukemia
    110322284 (Akt3)
   05218 Melanoma
    110322284 (Akt3)
   05211 Renal cell carcinoma
    110322284 (Akt3)
   05215 Prostate cancer
    110322284 (Akt3)
   05213 Endometrial cancer
    110322284 (Akt3)
   05224 Breast cancer
    110322284 (Akt3)
   05222 Small cell lung cancer
    110322284 (Akt3)
   05223 Non-small cell lung cancer
    110322284 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322284 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    110322284 (Akt3)
   05161 Hepatitis B
    110322284 (Akt3)
   05160 Hepatitis C
    110322284 (Akt3)
   05164 Influenza A
    110322284 (Akt3)
   05162 Measles
    110322284 (Akt3)
   05168 Herpes simplex virus 1 infection
    110322284 (Akt3)
   05163 Human cytomegalovirus infection
    110322284 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322284 (Akt3)
   05169 Epstein-Barr virus infection
    110322284 (Akt3)
   05165 Human papillomavirus infection
    110322284 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110322284 (Akt3)
   05135 Yersinia infection
    110322284 (Akt3)
   05152 Tuberculosis
    110322284 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110322284 (Akt3)
   05142 Chagas disease
    110322284 (Akt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110322284 (Akt3)
   05017 Spinocerebellar ataxia
    110322284 (Akt3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110322284 (Akt3)
   05418 Fluid shear stress and atherosclerosis
    110322284 (Akt3)
   05415 Diabetic cardiomyopathy
    110322284 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110322284 (Akt3)
   04931 Insulin resistance
    110322284 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322284 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110322284 (Akt3)
   01524 Platinum drug resistance
    110322284 (Akt3)
   01522 Endocrine resistance
    110322284 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110322284 (Akt3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110322284 (Akt3)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110322284 (Akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1 PH_11
Other DBs
NCBI-GeneID: 110322284
NCBI-ProteinID: XP_021054558
Ensembl: MGP_PahariEiJ_G0028186
LinkDB
Position
5
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggctataaggag
aaacctcaagatgtggacttaccttatccccttaacaacttctcagtggcaaaatgtcag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagacacaccagaggaaagagaagaatggacagaa
gctatccaagccgtagctgaccgattgcagaggcaagaagaggagaggatgaattgtagt
ccaacctcacagattgataatataggagaggaagagatggatgcatctacaacccatcat
aagagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaaa
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtacta
aagaacaccagacatccatttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggtggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctagat
aaggatggccatataaaaattacggattttggactttgcaaagaagggatcacagatgca
gcgaccatgaagacattctgtggtacaccagagtatctggcaccagaggtattagaagat
aatgactatggccgagccgtggactggtggggcctaggggttgtcatgtatgaaatgatg
tgtggaaggttgcctttctacaaccaggatcatgagaaactctttgaattaatactaatg
gaagacattaaattcccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggagggccggatgatgcaaaagaaatcatg
aggcatagttttttttctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgaaacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgatgacgacggcatggatggcatg
gacaacgagcgacggccacacttccctcagttctcctactctgccagtggacgggaataa

KEGG   Mus pahari (shrew mouse): 110324386
Entry
110324386         CDS       T05929                                 

Gene name
Akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110324386 (Akt1)
   04012 ErbB signaling pathway
    110324386 (Akt1)
   04014 Ras signaling pathway
    110324386 (Akt1)
   04015 Rap1 signaling pathway
    110324386 (Akt1)
   04370 VEGF signaling pathway
    110324386 (Akt1)
   04371 Apelin signaling pathway
    110324386 (Akt1)
   04630 JAK-STAT signaling pathway
    110324386 (Akt1)
   04668 TNF signaling pathway
    110324386 (Akt1)
   04066 HIF-1 signaling pathway
    110324386 (Akt1)
   04068 FoxO signaling pathway
    110324386 (Akt1)
   04072 Phospholipase D signaling pathway
    110324386 (Akt1)
   04071 Sphingolipid signaling pathway
    110324386 (Akt1)
   04024 cAMP signaling pathway
    110324386 (Akt1)
   04022 cGMP-PKG signaling pathway
    110324386 (Akt1)
   04151 PI3K-Akt signaling pathway
    110324386 (Akt1)
   04152 AMPK signaling pathway
    110324386 (Akt1)
   04150 mTOR signaling pathway
    110324386 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110324386 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    110324386 (Akt1)
   04218 Cellular senescence
    110324386 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324386 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110324386 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110324386 (Akt1)
   04613 Neutrophil extracellular trap formation
    110324386 (Akt1)
   04620 Toll-like receptor signaling pathway
    110324386 (Akt1)
   04625 C-type lectin receptor signaling pathway
    110324386 (Akt1)
   04660 T cell receptor signaling pathway
    110324386 (Akt1)
   04662 B cell receptor signaling pathway
    110324386 (Akt1)
   04664 Fc epsilon RI signaling pathway
    110324386 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    110324386 (Akt1)
   04062 Chemokine signaling pathway
    110324386 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110324386 (Akt1)
   04922 Glucagon signaling pathway
    110324386 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    110324386 (Akt1)
   04920 Adipocytokine signaling pathway
    110324386 (Akt1)
   04929 GnRH secretion
    110324386 (Akt1)
   04915 Estrogen signaling pathway
    110324386 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    110324386 (Akt1)
   04917 Prolactin signaling pathway
    110324386 (Akt1)
   04926 Relaxin signaling pathway
    110324386 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    110324386 (Akt1)
   04919 Thyroid hormone signaling pathway
    110324386 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110324386 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110324386 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    110324386 (Akt1)
   04728 Dopaminergic synapse
    110324386 (Akt1)
   04722 Neurotrophin signaling pathway
    110324386 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110324386 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    110324386 (Akt1)
   04213 Longevity regulating pathway - multiple species
    110324386 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324386 (Akt1)
   05205 Proteoglycans in cancer
    110324386 (Akt1)
   05207 Chemical carcinogenesis - receptor activation
    110324386 (Akt1)
   05208 Chemical carcinogenesis - reactive oxygen species
    110324386 (Akt1)
   05230 Central carbon metabolism in cancer
    110324386 (Akt1)
   05231 Choline metabolism in cancer
    110324386 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110324386 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110324386 (Akt1)
   05212 Pancreatic cancer
    110324386 (Akt1)
   05225 Hepatocellular carcinoma
    110324386 (Akt1)
   05226 Gastric cancer
    110324386 (Akt1)
   05214 Glioma
    110324386 (Akt1)
   05221 Acute myeloid leukemia
    110324386 (Akt1)
   05220 Chronic myeloid leukemia
    110324386 (Akt1)
   05218 Melanoma
    110324386 (Akt1)
   05211 Renal cell carcinoma
    110324386 (Akt1)
   05215 Prostate cancer
    110324386 (Akt1)
   05213 Endometrial cancer
    110324386 (Akt1)
   05224 Breast cancer
    110324386 (Akt1)
   05222 Small cell lung cancer
    110324386 (Akt1)
   05223 Non-small cell lung cancer
    110324386 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110324386 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    110324386 (Akt1)
   05161 Hepatitis B
    110324386 (Akt1)
   05160 Hepatitis C
    110324386 (Akt1)
   05164 Influenza A
    110324386 (Akt1)
   05162 Measles
    110324386 (Akt1)
   05168 Herpes simplex virus 1 infection
    110324386 (Akt1)
   05163 Human cytomegalovirus infection
    110324386 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110324386 (Akt1)
   05169 Epstein-Barr virus infection
    110324386 (Akt1)
   05165 Human papillomavirus infection
    110324386 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110324386 (Akt1)
   05135 Yersinia infection
    110324386 (Akt1)
   05152 Tuberculosis
    110324386 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110324386 (Akt1)
   05142 Chagas disease
    110324386 (Akt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110324386 (Akt1)
   05017 Spinocerebellar ataxia
    110324386 (Akt1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110324386 (Akt1)
   05418 Fluid shear stress and atherosclerosis
    110324386 (Akt1)
   05415 Diabetic cardiomyopathy
    110324386 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110324386 (Akt1)
   04931 Insulin resistance
    110324386 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110324386 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110324386 (Akt1)
   01524 Platinum drug resistance
    110324386 (Akt1)
   01522 Endocrine resistance
    110324386 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110324386 (Akt1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110324386 (Akt1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110324386 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110324386
NCBI-ProteinID: XP_021057572
Ensembl: MGP_PahariEiJ_G0029913
LinkDB
Position
7
AA seq 488 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSDSSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQVLLLSQWHSLRPGAVAGSPELLCVAE
PRSPAWVI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaacgacgtagccattgtgaaggagggctggctgcacaaacgaggggaatatattaaa
acctggcggccacgctacttcctcctcaagaacgatggcacctttattggctacaaggaa
cggcctcaggatgtggagcagcgagagtccccactcaacaacttctcagtggcacaatgc
cagctgatgaagacagagcggccaagacccaacacctttatcatccgctgtctgcagtgg
accacagtcatcgagcgcaccttccatgtggaaacgcctgaggagcgggaagagtggacc
accgccattcagactgtggccgatggactcaagaggcaggaggaagagacgatggacttc
cggtcaggctcacccagtgacagctcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctactgggcaagggcacc
tttgggaaggtgatcctggtgaaagagaaggcgacaggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgttgccaaggatgaggttgcccacacgcttactgagaaccgt
gtcctgcagaactctaggcatcccttccttacggccctcaagtactcattccagacccac
gaccgcctctgctttgtaatggagtatgccaacgggggcgagctcttcttccacctgtct
cgagagcgtgtgttctccgaggaccgggcccgcttctatggtgcggagattgtgtctgcc
ctggactacttgcactccgagaagaacgtggtgtaccgggacctgaagctggagaacctc
atgctggacaaggacgggcacatcaagataacggacttcgggctgtgcaaggaggggatc
aaggacggtgccactatgaagacattctgtggaacaccggagtacctggcccccgaggtg
ctggaggacaacgactatggccgtgcagtggactggtgggggctgggcgtggtcatgtat
gagatgatgtgtggccgcctgcccttctacaaccaggaccacgagaagctgttcgagctg
atcctcatggaggagatccgcttcccacgcacactcggccctgaggccaagtccctgctc
tctgggctactcaagaaggaccctacacagaggctcggtgggggctccgaggatgccaag
gagatcatgcagcaccgattctttgccaacatcgtgtggcaggatgtgtatgagaagaag
ctgagcccacctttcaagccccaggtcacctctgagactgacaccaggtatttcgatgag
gagttcacagctcagatgattaccatcacaccgcctgatcaagttctcctactcagccag
tggcacagcctgaggcctggggcagtggctggcagccctgagctgctctgcgttgccgag
cccagaagccccgcatgggtcatctga

DBGET integrated database retrieval system