KEGG   Mus pahari (shrew mouse): 110317492
Entry
110317492         CDS       T05929                                 

Gene name
Rxra
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03320  PPAR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04659  Th17 cell differentiation
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04932  Non-alcoholic fatty liver disease
mpah04976  Bile secretion
mpah05160  Hepatitis C
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05216  Thyroid cancer
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05226  Gastric cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110317492 (Rxra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110317492 (Rxra)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110317492 (Rxra)
   03320 PPAR signaling pathway
    110317492 (Rxra)
   04919 Thyroid hormone signaling pathway
    110317492 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    110317492 (Rxra)
  09154 Digestive system
   04976 Bile secretion
    110317492 (Rxra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317492 (Rxra)
   05202 Transcriptional misregulation in cancer
    110317492 (Rxra)
   05207 Chemical carcinogenesis - receptor activation
    110317492 (Rxra)
  09162 Cancer: specific types
   05226 Gastric cancer
    110317492 (Rxra)
   05216 Thyroid cancer
    110317492 (Rxra)
   05222 Small cell lung cancer
    110317492 (Rxra)
   05223 Non-small cell lung cancer
    110317492 (Rxra)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110317492 (Rxra)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110317492 (Rxra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317492 (Rxra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110317492 (Rxra)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110317492 (Rxra)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110317492 (Rxra)
Nuclear receptors [BR:mpah03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110317492 (Rxra)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 110317492
NCBI-ProteinID: XP_021047595
LinkDB
Position
3
AA seq 410 aa
MAAPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPXFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHYGVYSCEGCKGFFKRTVRKDL
TYTCXDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKXRNENEVESTSSAN
EDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIP
HFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFD
RVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHK
YPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEY
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggctgccccttcgctgcacccgtccttgggtccgggaatcggctctccactgggctcc
cctgggcagctgcactctcctatcagcaccctgagctcccccatcaatggcatgggtccg
nccttctctgtcatcagctcccccatgggcccgcactccatgtcggtacccactacaccc
acattgggcttcgggactggtagcccccagctcaattcacccatgaaccccgtgagcagc
agtgaggatatcaagccaccactaggcctcaatggcgtcctcaaggttcctgcccactac
ggggtatacagttgtgagggctgcaagggcttcttcaagaggacagtacgcaaggacctg
acctacacctgccnagacaacaaggactgcctgatcgacaagagacagcggaaccggtgt
cagtactgtcgctaccagaagtgcctggccatgggcatgaagcgggaagccgtgcaggag
gagcggcagcggggcaaggancggaatgagaacgaggtggagtccaccagcagtgccaac
gaggacatgcctgtagagaagattctggaagccgagctcgctgtcgagcccaagactgag
acatacgtggaggcaaacatggggctgaaccccagctcaccaaatgaccctgttaccaac
atctgtcaagcggcagacaagcagctcttcactcttgtggagtgggccaagaggatccca
cacttttctgagctgcccctggacgaccaggtcatcctgctacgggcaggctggaacgag
ctgctgatcgcctccttctcccaccgctccatagctgtgaaggatgggattctcctggcc
accggcctgcacgtacaccggaacagcgctcacagtgctggggtgggcgccatctttgac
agggtgctaacagagctggtgtctaagatgcgtgacatgcagatggacaagacggagctg
ggctgcctgcgagccattgtcctgttcaaccctgactctaaggggctctcaaaccctgct
gaggtggaggcactgagggagaaggtgtatgcgtcactagaagcatactgtaaacacaag
taccccgagcagccgggcaggtttgccaagctgctgctccgcctgcctgcactgcgttcc
atcggactcaagtgcctggagcacctgttcttcttcaagctcatcggggacacgcccatc
gacaccttcctcatggagatgctggagtattag

KEGG   Mus pahari (shrew mouse): 110321286
Entry
110321286         CDS       T05929                                 

Gene name
Rxrg
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03320  PPAR signaling pathway
mpah04659  Th17 cell differentiation
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05216  Thyroid cancer
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05226  Gastric cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110321286 (Rxrg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110321286 (Rxrg)
   03320 PPAR signaling pathway
    110321286 (Rxrg)
   04919 Thyroid hormone signaling pathway
    110321286 (Rxrg)
   04928 Parathyroid hormone synthesis, secretion and action
    110321286 (Rxrg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321286 (Rxrg)
   05202 Transcriptional misregulation in cancer
    110321286 (Rxrg)
   05207 Chemical carcinogenesis - receptor activation
    110321286 (Rxrg)
  09162 Cancer: specific types
   05226 Gastric cancer
    110321286 (Rxrg)
   05216 Thyroid cancer
    110321286 (Rxrg)
   05222 Small cell lung cancer
    110321286 (Rxrg)
   05223 Non-small cell lung cancer
    110321286 (Rxrg)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110321286 (Rxrg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110321286 (Rxrg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110321286 (Rxrg)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110321286 (Rxrg)
Nuclear receptors [BR:mpah03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110321286 (Rxrg)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110321286
NCBI-ProteinID: XP_021053155
Ensembl: MGP_PahariEiJ_G0028064
LinkDB
Position
5
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MRMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacaccggctcgacatccatgagcccttcggtagccttgcccacggggaagccaatggac
agccaccccagctacacagacaccccagtgagtgccccccggacgctgagcgctgtggga
acccccctcaatgctctcggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagcactggcagctcctccgggaatcaacttggtggctccacccagctctcagctc
aatgtggtcaacagtgtcagcagctctgaggacatcaagcccttaccaggtctgcctggc
attggaaatatgaactacccatccaccagccctgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggtgtgtacagctgtgaaggctgcaaa
ggcttcttcaaaaggaccatcaggaaagatctcatctacacctgccgggataacaaagat
tgtctcatcgacaagcgccagcgcaaccgctgccagtactgtcgctaccagaagtgcctg
gtcatgggcatgaagcgggaagctgtgcaagaagaaaggcagaggagccgagagcgagca
gagagtgaggcagaatgtgccagtagtagccatgaagacatgcccgtggagaggattcta
gaagctgaacttgctgtggaaccaaagacagaatcctacggtgacatgaacgtggagaac
tcaacaaatgaccctgttaccaacatatgccatgctgccgataagcaacttttcaccctc
gtggagtgggccaaacgcataccccacttctcagacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaatgaactgctgattgcctccttctcccaccgctcggtttcc
gtccaggatggcatcctgctggccaccgggctccacgtgcacaggagcagcgctcacagc
gcgggagtcggctccatcttcgacagagtcctcacagagttggtgtccaagatgaaagac
atgcggatggataagtcggagctggggtgcctacgggccatcgtgctgtttaatccagat
gccaagggtttatccaatccctctgaggtggagactcttcgagagaaggtttatgccacc
ctggaggcctataccaagcagaagtatccggaacagccaggcaggtttgccaagcttctg
ctgcgtctccctgctctgcgctccatcggcctgaaatgcctggaacacctcttcttcttt
aagctcattggcgacacccccatcgacagcttcctcatggagatgctggagaccccactg
cagatcacctga

KEGG   Mus pahari (shrew mouse): 110335436
Entry
110335436         CDS       T05929                                 

Gene name
Rxrb
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03320  PPAR signaling pathway
mpah04659  Th17 cell differentiation
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05216  Thyroid cancer
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05226  Gastric cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110335436 (Rxrb)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110335436 (Rxrb)
   03320 PPAR signaling pathway
    110335436 (Rxrb)
   04919 Thyroid hormone signaling pathway
    110335436 (Rxrb)
   04928 Parathyroid hormone synthesis, secretion and action
    110335436 (Rxrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110335436 (Rxrb)
   05202 Transcriptional misregulation in cancer
    110335436 (Rxrb)
   05207 Chemical carcinogenesis - receptor activation
    110335436 (Rxrb)
  09162 Cancer: specific types
   05226 Gastric cancer
    110335436 (Rxrb)
   05216 Thyroid cancer
    110335436 (Rxrb)
   05222 Small cell lung cancer
    110335436 (Rxrb)
   05223 Non-small cell lung cancer
    110335436 (Rxrb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110335436 (Rxrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110335436 (Rxrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110335436 (Rxrb)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110335436 (Rxrb)
Nuclear receptors [BR:mpah03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110335436 (Rxrb)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 110335436
NCBI-ProteinID: XP_021073244
Ensembl: MGP_PahariEiJ_G0020437
LinkDB
Position
18
AA seq 522 aa
MSWATRPPFLPPRPAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTL
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIPPASPPGPPLTPSAPPPPMPPPPLGS
PFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHC
PPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDK
RQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAV
EQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVIL
LRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
RMDKTELGCLRAIILFNPDAKGLSNPGEVEVLREKVYASLETYCKQKYPEQQGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcttgggccactcgtccgcccttcctcccgccgcggcctgccgcggggcagtgtggg
ccggtgggggtgagaaaagagatgcattgtggggtcgcgtcccggtggcggcggcggcgg
ccctggctggatcccgcggcggcggcggcggcggcggcggccggagagcagcaaaccctg
gagccggagccgggggaggctggccgggacgggatgggcgacagcgggcgggattcccga
agcccagacagctcctccccaaatcccctttcccaggggatccctccggcttctcctcct
ggcccacctcttaccccttcagcacctccacctccaatgccacccccgccactgggctcc
cccttcccagtcatcagttcttccatggggtcccctggtctgccccctccggctccccca
ggattctccgggcctgtcagcagccctcagatcaactccacagtgtcgctccctgggggt
ggctctggcccccctgaagatgtgaagccaccggtcttaggggtccgcggcctgcactgt
ccaccccctccaggtggccctggggctggcaaacggctttgtgcaatctgcggggaccga
agctcaggcaagcactatggggtttacagctgcgagggctgcaaggggttcttcaagcgc
accattcggaaggacctgacctactcgtgtcgcgataacaaagactgtacagtggacaag
cgccagcggaatcgctgtcagtactgtcgctatcagaagtgcctggccactggcatgaaa
agggaggcggttcaggaggagcgtcaacgggggaaggacaaagacggggatggagacggg
gctgggggagcccccgaggagatgcccgtggacaggatcctggaggcagagctcgctgtg
gagcagaagagtgaccaaggcgttgagggtcctggggggaccgggggtagtggcagcagc
ccaaatgacccagtgactaacatctgccaggcagccgacaaacagctgttcacactcgtt
gagtgggcaaagaggatcccgcacttctcctccctgcccctggacgaccaggtcatactg
ctgcgggcaggctggaacgagctcctcattgcatccttctcccatcggtccattgatgtc
cgagatggcatcctcctggccacgggtcttcatgtgcacagaaactcagcccattccgca
ggcgtgggagccatctttgatcgggtgctgacagagctagtgtccaaaatgcgtgacatg
aggatggacaagacagaacttggctgcctgcgggcaatcatactgtttaatccagatgcc
aagggcctctccaaccccggagaggtggaggtcctccgggagaaggtatacgcctcactg
gagacctactgcaagcagaagtaccctgagcagcagggccggtttgccaagctgctgtta
cgtcttcctgccctccgctccatcggcctcaagtgtctggagcacctgttcttcttcaag
ctcataggcgacacccccattgacaccttcctcatggagatgcttgaggctccccaccag
ctagcctga

DBGET integrated database retrieval system