KEGG   Mus pahari (shrew mouse): 110317699
Entry
110317699         CDS       T05929                                 
Name
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04724  Glutamatergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110317699
   04020 Calcium signaling pathway
    110317699
   04072 Phospholipase D signaling pathway
    110317699
   04024 cAMP signaling pathway
    110317699
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110317699
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317699
  09152 Endocrine system
   04911 Insulin secretion
    110317699
   04922 Glucagon signaling pathway
    110317699
   04923 Regulation of lipolysis in adipocytes
    110317699
   04912 GnRH signaling pathway
    110317699
   04913 Ovarian steroidogenesis
    110317699
   04915 Estrogen signaling pathway
    110317699
   04921 Oxytocin signaling pathway
    110317699
   04926 Relaxin signaling pathway
    110317699
   04935 Growth hormone synthesis, secretion and action
    110317699
   04918 Thyroid hormone synthesis
    110317699
   04928 Parathyroid hormone synthesis, secretion and action
    110317699
   04916 Melanogenesis
    110317699
   04924 Renin secretion
    110317699
   04925 Aldosterone synthesis and secretion
    110317699
   04927 Cortisol synthesis and secretion
    110317699
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110317699
   04270 Vascular smooth muscle contraction
    110317699
  09154 Digestive system
   04970 Salivary secretion
    110317699
   04971 Gastric acid secretion
    110317699
   04972 Pancreatic secretion
    110317699
   04976 Bile secretion
    110317699
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110317699
   04961 Endocrine and other factor-regulated calcium reabsorption
    110317699
  09156 Nervous system
   04724 Glutamatergic synapse
    110317699
   04728 Dopaminergic synapse
    110317699
   04726 Serotonergic synapse
    110317699
   04730 Long-term depression
    110317699
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110317699
  09159 Environmental adaptation
   04713 Circadian entrainment
    110317699
   04714 Thermogenesis
    110317699
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317699
   05207 Chemical carcinogenesis - receptor activation
    110317699
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110317699
   05165 Human papillomavirus infection
    110317699
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317699
   05142 Chagas disease
    110317699
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110317699
  09165 Substance dependence
   05030 Cocaine addiction
    110317699
   05031 Amphetamine addiction
    110317699
   05032 Morphine addiction
    110317699
   05034 Alcoholism
    110317699
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110317699
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110317699
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110317699
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110317699
   04031 GTP-binding proteins [BR:mpah04031]
    110317699
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110317699
  Exosomal proteins of other body fluids (saliva and urine)
   110317699
  Exosomal proteins of colorectal cancer cells
   110317699
  Exosomal proteins of bladder cancer cells
   110317699
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    110317699
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_29
Other DBs
NCBI-GeneID: 110317699
NCBI-ProteinID: XP_021047998
Ensembl: MGP_PahariEiJ_G0026198
LinkDB
Position
3:156601058..156651940
AA seq 1134 aa
MGMFNCLHGNNMSGQHDIPPEVGEQPEQEPLEAPGAAAPSAGAGPAEEMATEPDPEPSNN
EPVPDETGSEISGPPEDSKSDIQSPCQAFEEVRVGGDYSPPPEEAMPFETQQPSLGDFWP
TLEQPGPSGTPSGLQAFNPAILEPGTPTGASPGLGAYTPPPEEAMPFEFNEPAQGERSQP
PLQVPDLAPGGPEALVPRALPAEPRNIRFENAGFREDYSPPPEESVPFQVGGEEFGGDSP
PPGLPRVIPQIGIGGEFPTVAVPSALCLAPAENAPPLWVRGAIDRPFREAVRSPPNFACD
SPPMEITRPLLEIGRASIGVDDDTAVNMDSPPIASDGPPIEVSGAPDKSECAERPPVERE
AAEMEGSPTTAAAVEGKVPSPERGDGSSTQPEAMDAKPAPAAQAVSTGSDAGGAPLDSTM
LTDSQSDAGEDGTAPGTPSDLQSDPEELEEAPAVRAEPDGGAAPVAPATPAESESEGSRD
PAAEPASEAVPATTAESASGAAPVTQVEPAAAAVSATLAEPAARAAPITPTEPAIRAVPS
ARAHPAAGAVPGAPAMSASARAAAARAAYAGPLVWGARSLSATPAARASLPARAAAAARA
ASAARAVAAGRSASAAPSRAHLRPPSPEIQVADPPTPRPPPRPTAWPDKYERGRSCCRYE
ASSGICEIESSSDESEEGATGCFQWLLRRNRRPGLPRSHTVGSNPVRNFFTRAFGSCFGL
SECTRSRSLSPGKAKDPMEERRKQMRKEAIEMREQKRADKKRSKLIDKQLEEEKMDYMCT
HRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK
EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVR
ACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFH
MFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR
WLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYF
IRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgggcatgttcaactgcctccacggcaataatatgtcaggacaacacgatatcccccct
gaagtcggggagcagcccgagcaagaacctttggaagcccccggggcagctgcccccagt
gctggggctggcccagccgaagaaatggcgaccgaaccggaccccgaaccgtctaacaat
gagcccgtccccgacgagactggcagtgagatcagtggacccccagaagactccaaatct
gacatccagagcccctgccaggccttcgaggaagtccgagtgggtggagactacagccca
cctccggaggaagccatgccattcgagacacaacagcccagcctgggagatttctggccc
accctggagcagccaggaccatctgggaccccatcaggcctccaagccttcaatccagcg
attttggagcccgggacccccactggtgcgagcccaggcctgggagcctataccccccca
ccagaagaagctatgccatttgagttcaacgagcctgcccagggagagcgtagccagcct
cccttgcaagtcccagaccttgctccaggaggtccggaagcattggtccccagagctctt
cccgcggagcccaggaacatcagatttgaaaatgctggcttccgagaagactacagccct
ccccctgaagaatctgtgccatttcaggtcggtggagaagaattcgggggcgatagccca
cccccaggactcccgcgagtcatcccacaaatcggcattggcggcgagttcccgacagtc
gcggtcccgagtgcgctctgcctcgctcccgccgagaacgcgcctcccctctgggtccga
ggcgccattgacagaccattccgcgaggctgtcagatctcctcctaacttcgcatgcgac
agccccccgatggagatcaccagacccctgcttgagattggcagagcctccattggggtc
gacgacgacaccgctgtcaatatggacagccccccaatcgcaagtgatggcccgcccatc
gaagtctcgggagccccagataagagcgagtgcgcagagagacccccagttgagcgagaa
gcagcggagatggaaggaagccctaccaccgctgctgcggtggaaggaaaagtcccctct
ccggagagaggggacggatcttccacccagcctgaagcaatggatgccaagccagcccct
gctgcccaagccgtctctaccggatctgatgctggcggagctcctctggattccacgatg
ctcacagatagccagagcgatgccggagaagacgggacagccccaggaacgccttcagat
ctccagtcggatcctgaagaactcgaagaagccccagctgtccgcgccgagcctgacgga
ggggcagccccggtcgccccagcgactcctgccgagtccgagtctgaaggcagcagagat
ccagccgccgagccagcctccgaggcagtccctgccaccacggccgagtctgcctccggg
gcagcccctgtcacccaggtggagcccgcagccgcggcagtctctgccaccttggcggag
cctgccgcccgggcagcccctatcacccctacggagcccgctattcgggcagtcccctct
gctagagcccatccggccgctggagcagtccctggcgccccagcaatgtcagcctctgct
agggcagctgccgctagggcagcctatgcaggtccactggtctggggagccaggtcactc
tcagctactcccgccgctcgggcatcccttcctgcccgcgcagcagctgccgcccgggca
gcctctgctgcccgcgcagtcgctgctggccggtcagcctctgccgccccaagcagggcc
catcttagaccccccagccccgagatccaggttgctgacccgcctactccgcggcctcct
ccgcggccgactgcctggcctgacaagtacgagcggggccgaagctgctgcaggtatgag
gcatcgtctggcatctgcgagatcgagtcctccagtgatgagtcggaagaaggggccacc
ggctgcttccagtggcttctgcggcgaaaccgccgccctggcctgccccggagccacacg
gtcgggagcaacccagtccgcaacttcttcacccgagccttcggaagctgcttcggtcta
tccgagtgtacccgatcacgatccctcagccccgggaaggccaaggatcctatggaggag
aggcgcaaacagatgcgcaaagaagccattgagatgcgagagcagaagcgcgcagataag
aaacgcagcaagctcatcgacaagcaactggaggaggagaagatggactacatgtgtaca
caccgcctgctgcttctaggtgctggagagtctggcaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaacggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggctaccaaagtgcaggacatcaaaaacaacctgaag
gaggccattgaaaccattgtggccgccatgagcaacctggtaccccctgtggagctggcc
aaccctgagaaccagttcagagtggactacattctgagcgtgatgaacgtgccgaacttt
gacttcccacctgaattctatgagcatgccaaggctctgtgggaggatgagggagtgcgt
gcctgctacgaacgctccaatgagtaccagctgattgattgtgcccagtacttcctggac
aagattgatgtgatcaagcaggccgactacgtgccaagtgaccaggacctgcttcgctgc
cgtgtcctgacctctgggatctttgagaccaagttccaggtggacaaagtgaacttccac
atgttcgatgtgggcggccagcgcgatgaacgccgcaagtggatccagtgcttcaatgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcattcgggaggac
aaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgattctcttcctcaacaagcaagacctgcttgctgagaaa
gtcctcgctgggaaatcgaagattgaggactactttccagagttcgctcgctacaccact
cctgaggatgcgactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
atccgcgatgagtttctgagaatcagcactgctagtggagatggacgtcactactgctac
cctcactttacctgcgccgtggacactgagaacatccgccgtgtcttcaacgactgccgt
gacatcatccagcgcatgcatctccgccaatacgagctgctctaa

KEGG   Mus pahari (shrew mouse): 110317700
Entry
110317700         CDS       T05929                                 
Name
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04724  Glutamatergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110317700
   04020 Calcium signaling pathway
    110317700
   04072 Phospholipase D signaling pathway
    110317700
   04024 cAMP signaling pathway
    110317700
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110317700
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317700
  09152 Endocrine system
   04911 Insulin secretion
    110317700
   04922 Glucagon signaling pathway
    110317700
   04923 Regulation of lipolysis in adipocytes
    110317700
   04912 GnRH signaling pathway
    110317700
   04913 Ovarian steroidogenesis
    110317700
   04915 Estrogen signaling pathway
    110317700
   04921 Oxytocin signaling pathway
    110317700
   04926 Relaxin signaling pathway
    110317700
   04935 Growth hormone synthesis, secretion and action
    110317700
   04918 Thyroid hormone synthesis
    110317700
   04928 Parathyroid hormone synthesis, secretion and action
    110317700
   04916 Melanogenesis
    110317700
   04924 Renin secretion
    110317700
   04925 Aldosterone synthesis and secretion
    110317700
   04927 Cortisol synthesis and secretion
    110317700
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110317700
   04270 Vascular smooth muscle contraction
    110317700
  09154 Digestive system
   04970 Salivary secretion
    110317700
   04971 Gastric acid secretion
    110317700
   04972 Pancreatic secretion
    110317700
   04976 Bile secretion
    110317700
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110317700
   04961 Endocrine and other factor-regulated calcium reabsorption
    110317700
  09156 Nervous system
   04724 Glutamatergic synapse
    110317700
   04728 Dopaminergic synapse
    110317700
   04726 Serotonergic synapse
    110317700
   04730 Long-term depression
    110317700
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110317700
  09159 Environmental adaptation
   04713 Circadian entrainment
    110317700
   04714 Thermogenesis
    110317700
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317700
   05207 Chemical carcinogenesis - receptor activation
    110317700
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110317700
   05165 Human papillomavirus infection
    110317700
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317700
   05142 Chagas disease
    110317700
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110317700
  09165 Substance dependence
   05030 Cocaine addiction
    110317700
   05031 Amphetamine addiction
    110317700
   05032 Morphine addiction
    110317700
   05034 Alcoholism
    110317700
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110317700
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110317700
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110317700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110317700
   04031 GTP-binding proteins [BR:mpah04031]
    110317700
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110317700
  Exosomal proteins of other body fluids (saliva and urine)
   110317700
  Exosomal proteins of colorectal cancer cells
   110317700
  Exosomal proteins of bladder cancer cells
   110317700
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    110317700
SSDB
Motif
Pfam: NESP55 MARVEL
Other DBs
NCBI-GeneID: 110317700
NCBI-ProteinID: XP_021048011
Ensembl: MGP_PahariEiJ_G0026198
LinkDB
Position
3:156587738..156591892
AA seq 250 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRR
SFLNAHHRSAAAAAAAAAQVLPESSESESDHEHEEVEPELARPECLEYDQDDYETETDSE
TEPESDIESETEIETEPETEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQ
PTTQEPESASEGEELQRGPLDQDPRDPEESEERKEENRQPRRCKTKRPARRRDQSPESPP
RKGPIPIRRH
NT seq 753 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggctgccaccgctctcctctggctctcctgctccattgct
ctcctccgagccctagcctcttccaacgcccgcgcccagcagcgtgccgcccagcgccgg
agcttccttaacgcccaccaccgctccgctgccgctgccgctgcagctgccgcacaggta
ctccccgagtcctctgaatccgagtctgatcacgagcacgaggaggttgagcctgagctg
gcccgccccgagtgcctagagtacgatcaggacgactacgagaccgagaccgattctgag
accgagcctgagtccgatatcgaatccgagactgaaatcgagacggagccagagaccgag
ccagagaccgagccagaggacgagcgcggcccccggggcgccaccttcaaccagtcactc
actcagcgtctgcacgctctgaagttgcagagcgccgacgcctccccgagacgtgcgcag
cccaccactcaggagcctgagagcgcaagcgagggggaggagctccagagagggccctta
gatcaggatcctcgggaccccgaggagtcagaggagcgcaaggaggagaacaggcagccc
cgccgctgcaagaccaagaggccagcccgccgtcgcgaccagtccccggagtcccctccc
agaaaggggcccatccccatccggcgtcactaa

KEGG   Mus pahari (shrew mouse): 110332897
Entry
110332897         CDS       T05929                                 
Symbol
Gnal
Name
(RefSeq) guanine nucleotide-binding protein G(olf) subunit alpha isoform X1
  KO
K04633  guanine nucleotide-binding protein G(olf) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah05012  Parkinson disease
mpah05142  Chagas disease
mpah05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110332897 (Gnal)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110332897 (Gnal)
  09157 Sensory system
   04740 Olfactory transduction
    110332897 (Gnal)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110332897 (Gnal)
   05142 Chagas disease
    110332897 (Gnal)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110332897 (Gnal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110332897 (Gnal)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    110332897 (Gnal)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU TniB FtsK_SpoIIIE AAA_29
Other DBs
NCBI-GeneID: 110332897
NCBI-ProteinID: XP_021069906
Ensembl: MGP_PahariEiJ_G0019092
LinkDB
Position
15:60680562..60819604
AA seq 449 aa
MGLCYSLRPLLFGSSEDTPCAASESCAEDAQPSAAPAPAPIPAPAPVGTLLRRGGGRIGA
NVRPPGELQSRRRQEQLRAEEREGAKEARKVSRGIDRMLREQKRDLQQTHRLLLLGAGES
GKSTIVKQMRILHVEGGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQ
FRSDYIKSIAPITDFDYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSV
SLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAII
YVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGK
SKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTC
AVDTENIRRVFNDCRDIIQRMHLKQYELL
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgggcctgtgctacagcctgcggccgctgctcttcgggagctcagaggacaccccctgt
gcggcctcggaatcgtgcgcagaagatgcacaacccagcgccgccccggccccggccccg
atcccagccccggctccggtggggaccctgctccggcgtggcggcggccggatcggcgcg
aacgtgcggccgccaggcgagctgcagagccgccggcgacaggagcagttacgagccgag
gagcgcgagggagctaaagaggcgaggaaagtcagccggggcatcgaccgcatgctgcgc
gagcagaagcgcgacctgcagcagacgcaccggctcctgctgctgggagctggtgagtcc
gggaaaagcactatcgtcaaacagatgaggatcctgcacgttgaaggaggcttcaaccca
gaggaaaagaaacagaaaattctggacatcaggaaaaatgtcaaagatgctatcgtgaca
atcgtttcggcaatgagtactatcatacctccagtcccactggccaaccctgagaaccag
tttcggtcagactatatcaagagcatagcccctatcactgactttgactattcccaggag
ttctttgaccatgtgaagaagctgtgggacgatgagggagtgaaggcctgctttgagaga
tccaacgagtaccagctgatcgactgtgcacaatacttcctggaaaggattgacagtgtc
agtctggttgactacacgcccacagaccaggacctgctcagatgcagagtgctgacatca
ggaatctttgagacaagattccaggtggacaaagtgaactttcacatgtttgacgttgga
ggccagagagatgagagaagaaaatggatccagtgttttaatgatgtcaccgcgatcatt
tatgtggcggcctgcagtagctacaacatggtgatccgggaggacaacaacaccaacaga
ctgcgggaatcgctggacctgtttgaaagcatctggaataacaggtggttacgaaccatt
tctatcatcctgttcttgaacaaacaagatatgctggcagaaaaagtcttggcagggaag
tcaaaaatcgaagactatttcccggagtacgccaattatactgtccctgaagatgcaaca
cctgatgcgggagaagatcccaaagttacaagagcaaagttctttatccgggatctgttc
ttgaggatcagcacagccacgggtgacggcaaacattactgctaccctcacttcacctgc
gccgtggacacagagaacatccgcagagtgtttaatgactgccgtgacatcatccagaga
atgcatctcaagcagtacgaactcttgtga

DBGET integrated database retrieval system