KEGG   Mus pahari (shrew mouse): 110317715
Entry
110317715         CDS       T05929                                 

Gene name
Cry2
Definition
(RefSeq) cryptochrome-2
  KO
K02295  cryptochrome
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110317715 (Cry2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110317715 (Cry2)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    110317715 (Cry2)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6 ROQ_II
Other DBs
NCBI-GeneID: 110317715
NCBI-ProteinID: XP_021048041
Ensembl: MGP_PahariEiJ_G0025417
LinkDB
Position
3
AA seq 592 aa
MAAAAVVAATVPAQSMAADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPTVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQA
GSISNTGPRALSSGPTSPKRKLEAAEEPPGEELSKRARVTEMPAQEPPSKDS
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggcggcggctgctgtggtggcagcgacggtccctgcgcaatcgatggccgcagacggc
gcgtcctcggtgcactggttccgcaaaggactacggctccacgacaaccccgcgctgcta
gctgccgtgcgcggggcgcgctgtgtgcgctgcgtctacatcctcgacccgtggttcgcg
gcctcctcgtctgtgggcatcaaccgatggaggttcctactacaatctctagaagatctg
gacacaagcttaagaaagctgaattcccgtctgtttgtagtccggggacagccagctgat
gtgttcccaaggctgttcaaggaatggggggtgacccgtttgacctttgaatatgactct
gaaccctttgggaaagaacgggacgcagccattatgaagatggccaaggaggctggtgtg
gaggtggtgactgagaactctcacaccctctatgacctagacagaatcatcgaactgaat
gggcagaaaccaccccttacctacaagcgctttcaggccctcatcagccgcatggagctg
cccaagaagcccacggtggctgtgagcagccagcagatggagagctgcagggctgagatc
caggagaaccatgatgacacctatggcgtgccttccctagaggaactgggattccccacg
gaaggacttggcccagctgtttggcaaggaggagagacagaagctctggcccgcctggac
aagcacttggaacggaaggcctgggttgccaactatgagagacctcggatgaatgccaat
tccttgctggccagccccacgggcctcagcccctacctgcgctttggatgcctctcctgc
cgcctcttctactaccgcctgtgggacctatacaagaaggtgaagaggaacagcacaccc
cccctctccttatttggacaactcctgtggcgagagttcttctacacagcggccaccaac
aaccccaggtttgaccgaatggaggggaaccccatctgcatccagatcccctgggaccgc
aaccccgaagccctggccaagtgggccgagggcaagacaggcttcccttggattgacgcc
atcatgacccaactgaggcaggagggctggatccaccatctggcccggcacgctgtggcc
tgcttcctcacccgcggggacctctgggtcagctgggagagcggggtccgggtatttgac
gagctgctcctggatgcagatttcagtgtgaatgcaggcagctggatgtggctgtcctgc
agtgctttcttccaacaattcttccactgctactgccctgtgggctttggccgacgtaca
gaccccagtggggactatatccggcgatacctgcccaaattgaaaggcttcccctctcga
tacatctatgagccctggaatgcccccgagtcagttcagaaggccgccaagtgcatcatt
ggagtggactatccacggcccatcgtcaatcatgcagagactagtcggctcaacattgag
cgaatgaagcagatctaccaacagctgtcgagataccggggactctgtctgttggcatct
gtcccttcctgtgtggaagacctcagtcaccctgtggcagagcctggttcgagccaagct
gggagcatcagcaacacaggccccagagcactatccagtggcccaacttcccccaaacgc
aagctggaagcagccgaggaacctcctggtgaagaactgagcaagcgggctagagtgacg
gagatgcctgcccaagagccaccaagcaaggactcctga

KEGG   Mus pahari (shrew mouse): 110326483
Entry
110326483         CDS       T05929                                 

Gene name
Cry1
Definition
(RefSeq) cryptochrome-1 isoform X1
  KO
K02295  cryptochrome
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110326483 (Cry1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110326483 (Cry1)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    110326483 (Cry1)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6
Other DBs
NCBI-GeneID: 110326483
NCBI-ProteinID: XP_021060623
Ensembl: MGP_PahariEiJ_G0031401
LinkDB
Position
9
AA seq 608 aa
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGESVPSCSGGGNGGLVGYAPGE
NIPSCSGGGGNCSQGSGILHYTHGDSQQTHPLKQGRSSAGTGLSSGKRPSQEEDAQSVGP
KVQRQSSN
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgggggtgaacgccgtgcattggttccgaaagggactccggctccacgacaaccccgcc
ctgaaagagtgcatccagggcgccgacactatccgctgcgtctacatcctcgacccctgg
ttcgccggctcttccaacgtgggcatcaacaggtggcgatttttgcttcagtgtcttgag
gatcttgatgccaatctacgaaaattaaattctcgtctgtttgtgattcggggacagcca
gctgatgtatttcccaggcttttcaaggaatggaacatcactaaactctcaattgagtat
gattcagagccttttgggaaggaacgagatgcagctatcaagaagctggccactgaggct
ggcgtggaagtcatcgtgcgcatttcacatacgctgtatgacctggacaagatcatagaa
ctcaatggcggacagccacctctaacatataaaaggtttcagactcttgtcagcaagatg
gagccactggagatgccagcagataccatcacatcagatgtgataggaaagtgcacgacc
cctctgtctgatgaccatgatgagaaatatggagttccttccctggaagagcttggcttt
gatacagatggcctgtcctctgcagtgtggccaggaggagaaactgaggcacttacacgt
ttggaaaggcatttggaaagaaaggcctgggtggcaaactttgaaagacctcgaatgaat
gcaaactccctgcttgcaagccccactggactcagtccttatctccgctttggttgttta
tcatgtcggctgttttatttcaaactaacagatctctacaaaaaggtaaagaagaatagt
tcccctcccctttctctttatgggcaactcctgtggcgcgaattcttttatacagcagcc
acaaacaacccacgctttgacaaaatggaagggaaccccatctgtgttcagatcccttgg
gacaagaaccctgaggctctggccaaatgggcagaaggccggacaggcttcccgtggatt
gatgccatcatgacccagcttcgtcaggagggctggatccaccatttagccagacacgcg
gtcgcgtgcttcctgactcgtggtgacctgtgggtcagctgggaagaagggatgaaggtc
tttgaagagttactgcttgatgccgattggagcataaatgctggaagttggatgtggctg
tcctgcagttccttttttcaacagtttttccactgctactgccctgtggggtttggtagg
aggacagatcccaatggagactatattaggcgttatttgcctgtcctaagaggcttccct
gcaaaatatatctacgatccttggaatgcaccagaaggcatccagaaggtagccaagtgt
ctgataggagttaattaccccaaaccaatggtgaaccatgctgaggcaagccgattgaat
attgaaagaatgaagcagatttatcaacagctttcccggtacagagggctaggtcttctc
gcctcagtcccttctaactctaatgggaatggagggctcatgggctatgctcctggagag
agcgtcccgagctgtagcggcggcgggaatggagggctcgtgggctatgctcctggagag
aatatcccaagctgtagcggcggtggtggaaattgctctcaaggaagtggtattttacac
tacactcatggagacagtcagcagactcacccactgaagcaagggagaagctctgcaggc
accggcctcagcagtgggaagcgccctagtcaggaggaggatgcccagagtgtcggcccc
aaagtccagcgacagagcagtaactga

DBGET integrated database retrieval system