KEGG   Mus pahari (shrew mouse): 110317815
Entry
110317815         CDS       T05929                                 

Symbol
Plcb4
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04062  Chemokine signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04621  NOD-like receptor signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Module
mpah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110317815 (Plcb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110317815 (Plcb4)
   04310 Wnt signaling pathway
    110317815 (Plcb4)
   04371 Apelin signaling pathway
    110317815 (Plcb4)
   04020 Calcium signaling pathway
    110317815 (Plcb4)
   04070 Phosphatidylinositol signaling system
    110317815 (Plcb4)
   04072 Phospholipase D signaling pathway
    110317815 (Plcb4)
   04071 Sphingolipid signaling pathway
    110317815 (Plcb4)
   04022 cGMP-PKG signaling pathway
    110317815 (Plcb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110317815 (Plcb4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317815 (Plcb4)
   04613 Neutrophil extracellular trap formation
    110317815 (Plcb4)
   04621 NOD-like receptor signaling pathway
    110317815 (Plcb4)
   04062 Chemokine signaling pathway
    110317815 (Plcb4)
  09152 Endocrine system
   04911 Insulin secretion
    110317815 (Plcb4)
   04922 Glucagon signaling pathway
    110317815 (Plcb4)
   04929 GnRH secretion
    110317815 (Plcb4)
   04912 GnRH signaling pathway
    110317815 (Plcb4)
   04915 Estrogen signaling pathway
    110317815 (Plcb4)
   04921 Oxytocin signaling pathway
    110317815 (Plcb4)
   04926 Relaxin signaling pathway
    110317815 (Plcb4)
   04935 Growth hormone synthesis, secretion and action
    110317815 (Plcb4)
   04918 Thyroid hormone synthesis
    110317815 (Plcb4)
   04919 Thyroid hormone signaling pathway
    110317815 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    110317815 (Plcb4)
   04916 Melanogenesis
    110317815 (Plcb4)
   04924 Renin secretion
    110317815 (Plcb4)
   04925 Aldosterone synthesis and secretion
    110317815 (Plcb4)
   04927 Cortisol synthesis and secretion
    110317815 (Plcb4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110317815 (Plcb4)
   04270 Vascular smooth muscle contraction
    110317815 (Plcb4)
  09154 Digestive system
   04970 Salivary secretion
    110317815 (Plcb4)
   04971 Gastric acid secretion
    110317815 (Plcb4)
   04972 Pancreatic secretion
    110317815 (Plcb4)
   04973 Carbohydrate digestion and absorption
    110317815 (Plcb4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110317815 (Plcb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    110317815 (Plcb4)
   04725 Cholinergic synapse
    110317815 (Plcb4)
   04728 Dopaminergic synapse
    110317815 (Plcb4)
   04726 Serotonergic synapse
    110317815 (Plcb4)
   04720 Long-term potentiation
    110317815 (Plcb4)
   04730 Long-term depression
    110317815 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    110317815 (Plcb4)
  09157 Sensory system
   04742 Taste transduction
    110317815 (Plcb4)
   04750 Inflammatory mediator regulation of TRP channels
    110317815 (Plcb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110317815 (Plcb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317815 (Plcb4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110317815 (Plcb4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317815 (Plcb4)
   05142 Chagas disease
    110317815 (Plcb4)
   05143 African trypanosomiasis
    110317815 (Plcb4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317815 (Plcb4)
   05016 Huntington disease
    110317815 (Plcb4)
   05017 Spinocerebellar ataxia
    110317815 (Plcb4)
   05022 Pathways of neurodegeneration - multiple diseases
    110317815 (Plcb4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110317815 (Plcb4)
   05415 Diabetic cardiomyopathy
    110317815 (Plcb4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110317815 (Plcb4)
   04934 Cushing syndrome
    110317815 (Plcb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110317815 (Plcb4)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110317815 (Plcb4)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110317815 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110317815 (Plcb4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Other DBs
NCBI-GeneID: 110317815
NCBI-ProteinID: XP_021048271
Ensembl: MGP_PahariEiJ_G0025798
LinkDB
Position
3
AA seq 1187 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRQAAIPKDPKILAALETVGKSENDLEGRILCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRGITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESADQEEEAHPEYKFGNELSADDYSHKEAVANSVKKTSD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQ
SSSELRPTTTAALGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaattcaactggcagaaggaagtgccctctttcttgcaagaagga
gcagtttttgacagatatgaagaggaatctttcgtgtttgagcccaactgcctcttcaaa
gtggatgaattcggcttcttcctgacgtggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtattcgccaggcagccataccaaaggatcccaaaatcctg
gctgctctcgaaactgttggaaaatctgaaaatgatctggaagggcggatattgtgtgtc
tgcagcggcacggatctggtgaatatcagcttcacttacatggtggctgaaaatccagaa
gtaacgaagcaatgggtagaaggcctgagatcaatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaaacactggatgaaactggcctttctgaccaacaca
actgggaaaatcccagtgaggggcatcactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagccctcaaggaattaggtcttcccagtggaaagaatgatgaaattgag
cctgctgcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccattttacgatgctaaaagagcaatgcagatcattgagatgtatgaacctgatgaagag
ctgaagaaaaaaggcctcatatccagtgatggattctgcagatatctgatgtcagatgaa
aatgccccggtcttcctagatcgcttagagctttaccaggagatggaccaccccctggct
cattacttcatcagctcctcccacaacacctatctcaccggccggcaatttggaggaaag
tcttccgtggaaatgtacagacaagttctcttggctggttgcaggtgtgttgaactagac
tgttgggatggaaaaggtgaagatcaggaaccgataataactcacggaaaagcgatgtgt
acagacatcctttttaaggatgtaatccaagccatcaaggaaacggcgttcgtcacatca
gaatatcctgtcattctctcctttgaaaaccactgcagcaaatatcaacagtacaagatg
tccaagtattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcgcat
ccacttgaaccaggaaggcccttgccgtctcctaatgacctcaaaagaaaaatactcatc
aagaataaaaggctgaagcctgaagttgaaaagaaacagcttgaagctttgaaaagcatg
atggaagctggagagtctgcagcccctgctagcatcttggaagacgacaatgaagaggaa
atagaaagtgctgatcaagaggaagaagcccaccctgaatacaaatttggaaatgaactt
tctgccgatgactacagtcacaaggaagcggttgcaaacagcgtcaagaagacctcagat
gaccttgaacatgaaaacaacaaaaagggcctggtcaccgtagaggacgagcaagcatgg
atggcatcttataaatacgtaggtgctaccacaaacatccatccgtacttgtccacgatg
atcaactatgcacagcctgtgaagtttcaaggtttccacgtggctgaagagcgcaatatt
cactataacatgtcttcttttaacgagtcggttggccttggctacttgaagacgcatgca
attgagtttgtaaactacaataagcggcaaatgagccgcatttaccccaagggaggccga
gttgattccagtaattacatgcctcagattttctggaacgctggttgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcaaggaaaatttgagtataat
ggatcgtgcgggtaccttctcaagccagatttcatgaggcggcctgaccggacatttgac
cccttctctgaaacccctgtggacggggttattgcagccacatgctcagtacaggtgata
tcagggcagttcctctcagataagaagatcgggacatacgtggaagttgatatgtatggg
ctgcccaccgacaccatacggaaagagttccgaacccgcatggttatgaacaatggactc
aacccagtgtataatgaagaatcattcgtgtttcggaaggtgatcctgcctgacctagct
gtcctgagaatcgctgtctacgatgacaacaacaagctgattggccagaggatccttcct
ttggatggtctccaagcaggctaccgacacatctccctgagaaatgagggaaacaaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtagatgctttatccgatccaaagaaatttctttccatcacagagaagaga
gcagaccaaatgagagcaatgggcattgaaacgagtgacatagcagatgtgcccagtgat
acttccaaaaatgacaagaaaggcaaagccaacccagccaaagcgaacgtgacccctcag
agcagctctgagctcagaccaaccaccacagccgccctgggctctggccaggaagccaag
aaaggtattgaacttatccctcaagtgaggatagaagatttaaaacaaatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagttaaactctctaaagaagaagcatgcaaag
gagcacagtaccatgcagaagttacactgcacacaagttgacaaaattgtggcccagtat
gacaaagagaagtcgactcatgagaaaatcctagagaaagcgatgaagaagaagggggga
agtaattgtcttgaaataaaaaaagaaacagaaattaaaattcagaccttgacaacggat
cacaaatctaaggtcaaagagattgtggcccagcacacaaaggagtggtcagaaatgatc
aacactcacagtgcggaggagcaagaaatccgggatctgcacctgagccagcagtgtgag
ctgctgagaaagctgctcatcaacgctcacgagcagcagacccaacagctgaaactctcc
catgacagggaaagcaaggagatgagagcccatcaggctaagatttctatggaaaatagc
aaggccatcagtcaagacaaatctatcaagaataaggcagaacgtgaaaggcgagtcagg
gagttgaacagcagcaacactaaaaagttcctagaagaaagaaagagactggcgatgaag
cagtcgaaagaaatggatcagttgaaaaaggtccagctggagcacctagaattcctagag
aaacagaacgagcaggcgaaggagatgcagcagatggtgaaattggaagccgagatggac
cgcagaccagcaacagtagtatga

KEGG   Mus pahari (shrew mouse): 110318415
Entry
110318415         CDS       T05929                                 

Symbol
Plcb2
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04062  Chemokine signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04621  NOD-like receptor signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Module
mpah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110318415 (Plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110318415 (Plcb2)
   04310 Wnt signaling pathway
    110318415 (Plcb2)
   04371 Apelin signaling pathway
    110318415 (Plcb2)
   04020 Calcium signaling pathway
    110318415 (Plcb2)
   04070 Phosphatidylinositol signaling system
    110318415 (Plcb2)
   04072 Phospholipase D signaling pathway
    110318415 (Plcb2)
   04071 Sphingolipid signaling pathway
    110318415 (Plcb2)
   04022 cGMP-PKG signaling pathway
    110318415 (Plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110318415 (Plcb2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110318415 (Plcb2)
   04613 Neutrophil extracellular trap formation
    110318415 (Plcb2)
   04621 NOD-like receptor signaling pathway
    110318415 (Plcb2)
   04062 Chemokine signaling pathway
    110318415 (Plcb2)
  09152 Endocrine system
   04911 Insulin secretion
    110318415 (Plcb2)
   04922 Glucagon signaling pathway
    110318415 (Plcb2)
   04929 GnRH secretion
    110318415 (Plcb2)
   04912 GnRH signaling pathway
    110318415 (Plcb2)
   04915 Estrogen signaling pathway
    110318415 (Plcb2)
   04921 Oxytocin signaling pathway
    110318415 (Plcb2)
   04926 Relaxin signaling pathway
    110318415 (Plcb2)
   04935 Growth hormone synthesis, secretion and action
    110318415 (Plcb2)
   04918 Thyroid hormone synthesis
    110318415 (Plcb2)
   04919 Thyroid hormone signaling pathway
    110318415 (Plcb2)
   04928 Parathyroid hormone synthesis, secretion and action
    110318415 (Plcb2)
   04916 Melanogenesis
    110318415 (Plcb2)
   04924 Renin secretion
    110318415 (Plcb2)
   04925 Aldosterone synthesis and secretion
    110318415 (Plcb2)
   04927 Cortisol synthesis and secretion
    110318415 (Plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110318415 (Plcb2)
   04270 Vascular smooth muscle contraction
    110318415 (Plcb2)
  09154 Digestive system
   04970 Salivary secretion
    110318415 (Plcb2)
   04971 Gastric acid secretion
    110318415 (Plcb2)
   04972 Pancreatic secretion
    110318415 (Plcb2)
   04973 Carbohydrate digestion and absorption
    110318415 (Plcb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110318415 (Plcb2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110318415 (Plcb2)
   04725 Cholinergic synapse
    110318415 (Plcb2)
   04728 Dopaminergic synapse
    110318415 (Plcb2)
   04726 Serotonergic synapse
    110318415 (Plcb2)
   04720 Long-term potentiation
    110318415 (Plcb2)
   04730 Long-term depression
    110318415 (Plcb2)
   04723 Retrograde endocannabinoid signaling
    110318415 (Plcb2)
  09157 Sensory system
   04742 Taste transduction
    110318415 (Plcb2)
   04750 Inflammatory mediator regulation of TRP channels
    110318415 (Plcb2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110318415 (Plcb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318415 (Plcb2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110318415 (Plcb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110318415 (Plcb2)
   05142 Chagas disease
    110318415 (Plcb2)
   05143 African trypanosomiasis
    110318415 (Plcb2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110318415 (Plcb2)
   05016 Huntington disease
    110318415 (Plcb2)
   05017 Spinocerebellar ataxia
    110318415 (Plcb2)
   05022 Pathways of neurodegeneration - multiple diseases
    110318415 (Plcb2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110318415 (Plcb2)
   05415 Diabetic cardiomyopathy
    110318415 (Plcb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110318415 (Plcb2)
   04934 Cushing syndrome
    110318415 (Plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110318415 (Plcb2)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110318415 (Plcb2)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110318415 (Plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110318415 (Plcb2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2
Other DBs
NCBI-GeneID: 110318415
NCBI-ProteinID: XP_021049113
Ensembl: MGP_PahariEiJ_G0025564
LinkDB
Position
3
AA seq 1179 aa
MSLLNPVLLPPNVKAYLSQGERFIKWDDETSIASPVILRVDPKGYYLYWTHQNKEMEFLD
VTSIRDTRFGKFAKIPKSQKLREVFNMDFPDNHFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALAKHPMTANAPRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALGACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPARPEQVQVLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAHDTLLTHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDILFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGETLLTDPLENFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKKPGGV
AEGSLPSNVPVEEDTGWTAEDRTEVEEEEEEEESGSLDEEEIKKMQSDEGTAGLEVTAYE
EMSSLVNYIQPTKFISFEFSAQKNRSYVVSSFTELKAYELLSKASMQFVDYNKRQMSRVY
PKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEFMRRL
DKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLSP
TANSINPVWKEEPFIFEKILVPELASLRIAVMEEGNKFLGHRIIPINALHSGYHHLCLRS
ESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKYFNAHDKKSVKLKEVTGSLPERL
FSSGTPVASQSNGAPVSAGNGSAAPGTKAKGEEAKKEVTEPQTASLEELRELKGVVKLQR
RHEKELRELERRGARRWEELLQRGAAQLAELQTPAAGSKLRPGKGSRKKRTLPCEETVLV
VAPSEPPDGADPRVQELKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAREKQA
AELKTFKETSETDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQEVVQA
VKQMTETLERHQEKLEERQTACLGQIQAMEKQFQEKALAEYEAKMKGLEAEVKESVRACF
KVCFSAEAEDKPERPCEASEEPCSQEPLVSKADTQESRL
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgtctttgctcaaccctgtcctgttgccccctaacgtgaaggcatatctgagccaaggg
gagcgcttcatcaagtgggacgatgaaacttcaatagcctctccagttatcctccgtgtg
gatcccaagggctattacttatactggacgcatcaaaataaggagatggaattcctggat
gtcacgagcatccgtgacactcgctttgggaagtttgcaaagatacccaagagccagaaa
ctccgtgaggtcttcaacatggactttccagacaaccacttcctgctaaaaacgctcaca
gtggtgtccggccctgacatggtggacctcaccttccacaactttgtctcttacaaggag
aacgtaggcaaggactgggctgaggacgtgctggctctcgccaaacacccgatgacagcc
aatgctccccgaagcacattcctggacaagatcctggtaaagcttaagatgcagctcaac
cctgaagggaagattcctgtgaagaactttttccagatgtttcctgctgatcgcaaacgg
gtggaagctgccctcggtgcctgtcaccttgcaaaaggcaaaaatgatgctatcaatcca
gaggacttccctgaatctgtgtacaagagcttcctcatgagcctatgtcctcggccagaa
atcgacgagatcttcacttcctaccacgctaaagctaaaccctatatgaccaaggagcac
ctgaccaaattcatcaatcagaagcaacgagaccctcgactcaactccttgctgttcccg
ccagcccggcctgagcaggtgcaggtgctcattgacaagtacgaacccagcggcatcaat
gtgcagaggggccagctgtcgccagaggggatggtctggtttctttgtggaccagagaac
agcgtgctggcccacgatacactgctgacccaccaagacatgacacagccactgaatcac
tacttcatcaattcctcacacaacacctacctgacagctggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctgtcgggctgccgttgtgtagagctagactgt
tggaagggcaagccccccgacgaagagcccatcatcacccacggcttcaccatgaccaca
gatattttgttcaaggaagcaatcgaagccattgccgaaagtgcctttaagacctcccca
tatcccgtcatcctgtcatttgaaaaccacgtggactcaccccgccaacaggctaagatg
gctgagtactgcaggaccatgtttggagagaccttgctcacagatcccctggaaaatttt
cctctgaaacctggcatccctctgcccagccccgaggacctccggggtaagatcctcatt
aagaataagaagaaccagttttctgggccagcatcccccagcaagaagcctggtggggtg
gctgagggcagcctcccatctaatgtccctgtcgaagaggacacagggtggactgctgag
gaccggactgaggtggaagaggaggaggaagaggaggagtcaggaagcctggatgaagaa
gaaattaagaagatgcagtcggatgagggcacagcgggcctggaggtgacagcttatgag
gaaatgtccagccttgtcaattatatccagcccaccaagtttatctccttcgagttctct
gcacagaagaacagaagttacgttgtctcttccttcacggagctcaaggcctacgagctg
ctctccaaggcctccatgcagtttgtggactataataaacgccagatgagccgtgtgtac
cccaagggcacacgcatggactcttccaactacatgccccagatgttctggaatgctgga
tgtcagatggttgccctcaatttccagacaatggacctgcccatgcagcagaacatggca
gtgtttgagttcaacgggcagagtggctacctcctaaagcatgagttcatgcgcagactg
gacaagcagttcaaccccttctctgtggatcgaattgatgtggtggtagccaccaccctt
tccattacggtcatctctgggcagtttctgtcagagcgcagtgtgcgcacctatgtggaa
gtggaactgtttggtctcccaggggaccccaagaggcggtatcgtaccaagctgtcacct
actgctaactccatcaatcctgtctggaaagaggagccctttatctttgagaagatcctg
gtgcctgagctggcctccctcaggatagctgtgatggaagaaggcaacaaatttcttgga
caccgcatcatccccatcaatgccttacattctggataccaccatctgtgccttcgaagt
gagagcaacatgccccttaccatgcctgctctatttgtcttcctggagatgaaggactac
gtacctgacacgtgggcagatcttacagtggcccttgccaaccccatcaagtacttcaat
gcccatgataagaagtccgtgaagctcaaagaagtgacaggaagtctgcctgagaggctc
ttctcctctgggacacctgttgccagtcagtccaatggggcaccagtctcggcaggcaat
gggtcagcagcacccgggaccaaggccaagggggaagaagctaagaaagaagtgacagag
ccacagaccgccagcttggaagagctgcgggaactgaagggcgtggtgaagctgcagcgg
aggcacgagaaggagcttcgagagctggagcgccgtggagcccggcgttgggaggaactg
ctgcagcgtggcgccgcacagctggcggagctccagaccccggcagcgggcagcaagctc
cgcccgggcaagggctcccgcaagaagaggaccctgccctgtgaggagaccgtcctcgtc
gtggcgcctagcgagccccccgacggggcggacccgcgcgtgcaggagctgaaggacagg
ctggagcaggagctgcagcagcaaggcgaggagcagtaccgctctgtcctcaagcgcaag
gagcagcacgtgaccgagcaaatcgccaagatgatggagctggccagagagaaacaggct
gccgaactcaagaccttcaaggaaacctcggaaactgacaccaaagaaatgaagaaaaaa
ctggaggccaagaggctggaacggatccaagccatgaccaaggtcaccacagacaaggtg
gcccaggagaggctcaagagagaaattaacaattcccacatccaggaagtggtccaggct
gtcaagcagatgacagagaccctggagcgtcaccaggagaagctggaagagaggcagaca
gcctgcctggggcagatccaggcaatggaaaagcagttccaggagaaggcgctggcagag
tatgaggccaagatgaagggcctggaggctgaagtaaaggagtcggtgcgggcctgcttc
aaggtctgcttctctgctgaagcagaagacaagcccgagaggccctgtgaggcctctgag
gagccatgttcacaggaaccacttgtgagcaaggcagacacccaggagagccgcctctga

KEGG   Mus pahari (shrew mouse): 110319646
Entry
110319646         CDS       T05929                                 

Symbol
Plcb1
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04062  Chemokine signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04621  NOD-like receptor signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Module
mpah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110319646 (Plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110319646 (Plcb1)
   04310 Wnt signaling pathway
    110319646 (Plcb1)
   04371 Apelin signaling pathway
    110319646 (Plcb1)
   04020 Calcium signaling pathway
    110319646 (Plcb1)
   04070 Phosphatidylinositol signaling system
    110319646 (Plcb1)
   04072 Phospholipase D signaling pathway
    110319646 (Plcb1)
   04071 Sphingolipid signaling pathway
    110319646 (Plcb1)
   04022 cGMP-PKG signaling pathway
    110319646 (Plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110319646 (Plcb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110319646 (Plcb1)
   04613 Neutrophil extracellular trap formation
    110319646 (Plcb1)
   04621 NOD-like receptor signaling pathway
    110319646 (Plcb1)
   04062 Chemokine signaling pathway
    110319646 (Plcb1)
  09152 Endocrine system
   04911 Insulin secretion
    110319646 (Plcb1)
   04922 Glucagon signaling pathway
    110319646 (Plcb1)
   04929 GnRH secretion
    110319646 (Plcb1)
   04912 GnRH signaling pathway
    110319646 (Plcb1)
   04915 Estrogen signaling pathway
    110319646 (Plcb1)
   04921 Oxytocin signaling pathway
    110319646 (Plcb1)
   04926 Relaxin signaling pathway
    110319646 (Plcb1)
   04935 Growth hormone synthesis, secretion and action
    110319646 (Plcb1)
   04918 Thyroid hormone synthesis
    110319646 (Plcb1)
   04919 Thyroid hormone signaling pathway
    110319646 (Plcb1)
   04928 Parathyroid hormone synthesis, secretion and action
    110319646 (Plcb1)
   04916 Melanogenesis
    110319646 (Plcb1)
   04924 Renin secretion
    110319646 (Plcb1)
   04925 Aldosterone synthesis and secretion
    110319646 (Plcb1)
   04927 Cortisol synthesis and secretion
    110319646 (Plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110319646 (Plcb1)
   04270 Vascular smooth muscle contraction
    110319646 (Plcb1)
  09154 Digestive system
   04970 Salivary secretion
    110319646 (Plcb1)
   04971 Gastric acid secretion
    110319646 (Plcb1)
   04972 Pancreatic secretion
    110319646 (Plcb1)
   04973 Carbohydrate digestion and absorption
    110319646 (Plcb1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110319646 (Plcb1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110319646 (Plcb1)
   04725 Cholinergic synapse
    110319646 (Plcb1)
   04728 Dopaminergic synapse
    110319646 (Plcb1)
   04726 Serotonergic synapse
    110319646 (Plcb1)
   04720 Long-term potentiation
    110319646 (Plcb1)
   04730 Long-term depression
    110319646 (Plcb1)
   04723 Retrograde endocannabinoid signaling
    110319646 (Plcb1)
  09157 Sensory system
   04742 Taste transduction
    110319646 (Plcb1)
   04750 Inflammatory mediator regulation of TRP channels
    110319646 (Plcb1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110319646 (Plcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319646 (Plcb1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110319646 (Plcb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110319646 (Plcb1)
   05142 Chagas disease
    110319646 (Plcb1)
   05143 African trypanosomiasis
    110319646 (Plcb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110319646 (Plcb1)
   05016 Huntington disease
    110319646 (Plcb1)
   05017 Spinocerebellar ataxia
    110319646 (Plcb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110319646 (Plcb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110319646 (Plcb1)
   05415 Diabetic cardiomyopathy
    110319646 (Plcb1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319646 (Plcb1)
   04934 Cushing syndrome
    110319646 (Plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110319646 (Plcb1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110319646 (Plcb1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110319646 (Plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110319646 (Plcb1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 110319646
NCBI-ProteinID: XP_021050812
Ensembl: MGP_PahariEiJ_G0025797
LinkDB
Position
3
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
RLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQSNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKP
KLQMELEQEYQDKFKRLPLEVLEFVQEAMKGKISEDSNHGSAPPSLASDAAKVNLKSPSS
EEVERENPGREFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggctggggctcagcccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgttactcca
attattttgaggactgatcctcagggatttttcttttactggacagaccagaataaggag
acggagctgttagatctcagccttgtcaaagatgccaggtgtgggaagcacgccaaagct
cccaaggaccccaagttgcgtgaacttctggatgttgggaacatcggacacttggaacag
cgcatgataactgtggtgtatggaccagacctggtgaacatttcccacttgaatcttgtg
gcttttcaagaggaagtggccaaggaatggacaaatgaggttttcagcttggcaacaaac
ctgctggctcagaacatgtccagggacgcatttctggagaaagcatatactaagctcaag
cttcaggtcaccccagagggccgcattcctctcaaaaacatctatcgattgttctcagca
gaccggaagcgagttgagactgcgctagaggcttgtagtcttccatcttcaaggaatgat
tccattccccaggaggacttcactccagatgtatacagagttttcctgaacaatctctgc
ccccgacctgaaattgataacatcttttccgaatttggtgccaaaagcaagccgtacctt
actgttgatcagatgatggattttatcaaccttaagcagagagatcctcggctaaatgaa
atactttacccacctctgaagcaggagcaggtccaagtgttgattgagaaatatgagccc
aacagcagcctcgccaagaaagggcagatgtcagtggatggattcatgcgctacctgagc
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaacgaagacatgtctcag
cccctgtcacactatttcatcaattcctcgcacaacacctacctcacagctggccagttg
gctgggaactcgtctgtagagatgtatcgccaggtgcttctgtctggatgtcgctgtgtg
gagctggactgctggaagggaaggaccgctgaggaagagcccgtcatcacccacggattc
accatgacaacagaaatatccttcaaggaagtcatagaagccatcgcagagtgtgcgttc
aagacgtctcctttccccatcctcctttcttttgagaaccacgtggattccccaaagcaa
caagccaagatggccgagtattgccgattaatctttggtgatgccctccttatggaacca
ctggaaaaatacccactggaatctggggtacctcttccaagccctatggatttaatgtat
aaaatcttggtgaaaaacaagaagaagtcacacaagtcgtcagagggaagtggtaaaaag
cggctttctgagcaagcttccaacacctacagcgactcctccagcgtgttcgagccttcg
tctccaggagctggggaagcagatacggagagtgatgacgatgacgacgatgatgactgt
aaaaagtcttccatggatgaggggactgctggcagcgaagccatggccacggaagagatg
tctaacctggtgaactacattcagcctgtcaagtttgagtcctttgaaatttcaaaaaaa
agaaataaaagctttgaaatgtcttccttcgtggaaaccaaaggacttgaacaacttaca
aagtctccggtggaatttgtagaatacaacaagatgcaacttagcaggatatatcccaag
ggaacacgcgtggattcatccaactacatgcctcaactcttctggaatgctggctgtcag
atggtggcgctcaacttccagacagtggatctagctatgcagataaacatgggcatgtat
gaatacaacgggaagagtggctacaggctgaagccagaattcatgaggaggccggacaag
cattttgatccatttactgaaggaatcgtagatgggatagtggccaatactttatctgtt
aagattatttcaggtcagtttctctctgataagaaagttgggacttacgtggaagtggat
atgtttggcttgcctgtggacacaaggaggaaggcatttaaaaccaagacatcccaagga
aatgctgtaaaccctgtctgggaagaagaacctattgtattcaaaaaggtagttctacct
tctctggcctgtttgaggatagcagcatatgaagagggaggcaaatttattggccaccgg
atattgcctgtgcaggctatacggccaggctatcactacatctgcctgcggaatgagagg
aaccagcccctgatgctgccagctgtctttgtctacattgaagtcaaagactatgtgcca
gacacatacgcagatgtgatcgaagctctatcaaacccaatccgatatgtcaatctcatg
gaacagagagctaagcagctggctgcgttgacactggaggatgaagaggaagtaaagaag
gaggctgaccctggagaaacatcatctgaggctccaagcgaaaccaggacaacaccagca
gagaatggggtgaatcacaccgcctcccttgcccccaagcctccttcccaggctccacac
agccagcctgctccagggtctgtgaaggcacctgccaaaacagaagatctgatccagagc
gtgttaacagaagtagaggcgcaaaccatcgaagagctcaagcaacagaaatcgttcgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggtgaagagacaccacaagaaa
accacggagctcatcaaggagcacacgaccaagtacaatgagattcagaatgactacctg
agaaggagggcagccttggagaagtccgccaaaaaggacagcaagaagaaatctgaaccc
agcagccctgaccacggctcatcagccattgagcaagacctcgctgccctggatgcagaa
atgactcagaagttgatagacttgaaagacaagcaacaacagcagctgcttaatcttcgg
caagagcagtattacagcgagaagtaccagaagcgagaacacattaaactgcttattcag
aagttgacagatgttgcggaagagtgtcagagcaatcagttaaagaagctgaaagaaatc
tgtgagaaagagaagaaggaattaaagaagaaaatggacaagaaaaggcaggagaagata
acagaagccaagtccaaggacaagagccagatggaagaggagaagacagagatgatccga
tcatacatccaggaggtggtgcagtacatcaagaggttagaggaagcacaaagtaaaaga
caagaaaaacttgtggagaaacacaatgagatccgccagcagatcctagatgagaagccc
aagctgcagatggagctggaacaagaataccaagacaagttcaaaagactgcccctggag
gttctggagtttgttcaggaagccatgaaaggaaagatcagtgaggatagcaatcatggc
tctgcccctccctccttggcctcagacgctgcaaaggtgaacctcaagtctccctccagt
gaggaggtagaaagagagaacccaggaagagagtttgatactcctctgtga

KEGG   Mus pahari (shrew mouse): 110336671
Entry
110336671         CDS       T05929                                 

Symbol
Plcb3
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04062  Chemokine signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04621  NOD-like receptor signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Module
mpah_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110336671 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110336671 (Plcb3)
   04310 Wnt signaling pathway
    110336671 (Plcb3)
   04371 Apelin signaling pathway
    110336671 (Plcb3)
   04020 Calcium signaling pathway
    110336671 (Plcb3)
   04070 Phosphatidylinositol signaling system
    110336671 (Plcb3)
   04072 Phospholipase D signaling pathway
    110336671 (Plcb3)
   04071 Sphingolipid signaling pathway
    110336671 (Plcb3)
   04022 cGMP-PKG signaling pathway
    110336671 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110336671 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110336671 (Plcb3)
   04613 Neutrophil extracellular trap formation
    110336671 (Plcb3)
   04621 NOD-like receptor signaling pathway
    110336671 (Plcb3)
   04062 Chemokine signaling pathway
    110336671 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    110336671 (Plcb3)
   04922 Glucagon signaling pathway
    110336671 (Plcb3)
   04929 GnRH secretion
    110336671 (Plcb3)
   04912 GnRH signaling pathway
    110336671 (Plcb3)
   04915 Estrogen signaling pathway
    110336671 (Plcb3)
   04921 Oxytocin signaling pathway
    110336671 (Plcb3)
   04926 Relaxin signaling pathway
    110336671 (Plcb3)
   04935 Growth hormone synthesis, secretion and action
    110336671 (Plcb3)
   04918 Thyroid hormone synthesis
    110336671 (Plcb3)
   04919 Thyroid hormone signaling pathway
    110336671 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    110336671 (Plcb3)
   04916 Melanogenesis
    110336671 (Plcb3)
   04924 Renin secretion
    110336671 (Plcb3)
   04925 Aldosterone synthesis and secretion
    110336671 (Plcb3)
   04927 Cortisol synthesis and secretion
    110336671 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110336671 (Plcb3)
   04270 Vascular smooth muscle contraction
    110336671 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    110336671 (Plcb3)
   04971 Gastric acid secretion
    110336671 (Plcb3)
   04972 Pancreatic secretion
    110336671 (Plcb3)
   04973 Carbohydrate digestion and absorption
    110336671 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110336671 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110336671 (Plcb3)
   04725 Cholinergic synapse
    110336671 (Plcb3)
   04728 Dopaminergic synapse
    110336671 (Plcb3)
   04726 Serotonergic synapse
    110336671 (Plcb3)
   04720 Long-term potentiation
    110336671 (Plcb3)
   04730 Long-term depression
    110336671 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    110336671 (Plcb3)
  09157 Sensory system
   04742 Taste transduction
    110336671 (Plcb3)
   04750 Inflammatory mediator regulation of TRP channels
    110336671 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110336671 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336671 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110336671 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110336671 (Plcb3)
   05142 Chagas disease
    110336671 (Plcb3)
   05143 African trypanosomiasis
    110336671 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110336671 (Plcb3)
   05016 Huntington disease
    110336671 (Plcb3)
   05017 Spinocerebellar ataxia
    110336671 (Plcb3)
   05022 Pathways of neurodegeneration - multiple diseases
    110336671 (Plcb3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110336671 (Plcb3)
   05415 Diabetic cardiomyopathy
    110336671 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110336671 (Plcb3)
   04934 Cushing syndrome
    110336671 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110336671 (Plcb3)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110336671 (Plcb3)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110336671 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110336671 (Plcb3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 110336671
NCBI-ProteinID: XP_021075073
Ensembl: MGP_PahariEiJ_G0014115
LinkDB
Position
1
AA seq 1235 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFPLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARQLIEKYETNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLSAGIPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGPEKTSLEPQKSLGE
EGLSQGPNVPVPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDKKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGRFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTETLQETPCQQ
PGSQLPSNPTPNPLDASPRWLPGPTTSPTSSSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMAKLRSRQDRDLRELRKKHQRKAVALTRRLLDGLAQARAEGKCRPSPSALGKATNVE
DVKEEEEEAKQYREFQNRQVQSLLELREAQADVETKRRLEHLRQAHQRLKEVVLDTHTTQ
FKKLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRRL
EEAQKQRHERLVAGQQQVLQQLEEEEPKLLAQLTQECKEQRERLPQEIRRCLLGETSEGL
GDGPLVACASNGHAPGSGGHLSSADSESQEENTQL
NT seq 3708 nt   +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcgcaacctg
gtgaccctgcgtgtggaccccaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgtctg
cccaaggaccctaagattcgagaagtactgggctttgggggtcctgacacccggctagag
gagaaactgatgacagtggtggccgggccagatccagtaaataccacgttcttgaacttc
atggctgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaaactggctatg
aacatactggctcagaatgcctcccggaacaccttcctgcggaaagcatacacgaagctg
aagctgcaggtgaaccaggatggacggattccggtcaagaacattctgaagatgttctca
gcggacaagaagcgggtggagacggcgctggagtcctgtggcctcaacttcaaccggagt
gagtccattcgccctgatgagtttcccttggaaatctttgagcggttcttgaacaaactg
tgtctgcgcccggatattgacaagatcctgctagagataggtgccaagggcaagccgtac
ctcactctggagcagcttatggactttatcaaccagaagcagagagacccaagactcaat
gaagtgctgtacccgccgctccggtcctcacaggctcggcagctcattgagaagtatgag
acgaataaacagttcctggagcgtgaccagatgtctatggagggcttcagccgctacctg
ggaggggaggagaacggtatcctgcctctggaggccctggatctgagcatggacatgacc
cagccactgagcgcatacttcatcaattcctcacacaacacctatctcactgcgggccag
ctggctggaacatcatcggtggagatgtaccgccaggcgctgctgtggggctgccgctgt
gtggagttggatgtatggaagggacggccaccggaggaagagcccttcatcactcatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgctagaggccatcgctgagacagcc
ttcaagacctcaccctaccctgtcatcctctccttcgagaaccatgtcgactcggcaaag
cagcaggccaagatggctgagtactgccgctctatctttggggatgcgctgctcattgac
ccactcgacaaatacccgctatctgcgggcatccccctgcctagtccacaggacctgatg
ggccgtatcctggtgaagaataaaaagcggcatcggcccagcacaggcgtccctgacagc
tcagtacgcaagcggcctctggaacagagcaactcggccttgagtgagagctcggccgcc
acagagccctcctcaccccagcttgggtctcccagctccgacagctgccctggcctaagc
aatggggaggaggtaggacccgagaagaccagcctggagcctcagaagtctctgggtgag
gagggcctcagccagggacctaatgtgcccgtgcctgaccgcgaccgagaggatgaggag
gaagatgaggaagaggaggaaacgacggatccaaaaaagcccaccactgatgagggcaca
gccagcagtgaggtcaatgccacggaggagatgtcaacgctcgtcaactacgttgagccc
gtcaagttcaagtcctttgaggctgctcgaaaaagaaacaagtgcttcgagatgtcatcc
tttgtggagaccaaggcaatggagcaactgaccaagagtcccatggagtttgtggaatac
aacaaacagcagctcagccgcatctaccccaagggcacacgagtggactcctccaactac
atgcctcagctcttctggaacgtgggttgccagcttgttgccctcaacttccagactttg
gatttgccaatgcagctcaacgcaggcgtgtttgaatacaatgggcgcagtgggtacttg
ctgaagcctgagtttatgcggcggccggacaagtcttttgaccccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagttcctgtct
gacaagaaggtgggcatctacgtcgaggtggacatgtttggcctcccagttgacacgaga
cgcaaatatcgtacacggacatcccaggggaactcatttaaccctgtgtgggatgaggaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcgcttcgcatcgcagccttt
gaggagggtggcagatttgttgggcaccgtatcctgcctgtctctgccatccgctcaggg
tatcactatgtctgcctgcgaaatgaggccaaccaacccttgtgcctgcccgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
attaaccccatcaagcacgtcagcctaatggaccagcgggccaagcaactggctgctctc
attggggagagtgaggctcaggccagtacagagacattgcaggagaccccgtgtcaacag
ccagggtcacagctcccctccaaccccacacctaacccactggatgcctcgcctcgctgg
ctccccggtcctaccacttcccccactagctcctccctcagtagcccagggcagcgagat
gatttgattgccagcatcctctctgaggtgacccctacacctctagaagagctccgaagc
cacaaggctatggcgaagctccggagccggcaggatcgagacctgcgggagctgcgtaag
aagcaccagcgcaaggccgtggctctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcccccagtgccctgggcaaggccaccaatgtagag
gatgtgaaggaggaagaagaggaggccaaacagtatcgagagttccagaaccgacaagtc
cagagcctgctggagctgagggaagcccaggcagatgtggagaccaagcggaggctggag
catctgcgacaggctcatcagcggctcaaggaagttgtcctggatacacacacaactcag
ttcaagaagctgaaggagctgaatgaaagggagaagaaggagcttcagaagatcctggac
aggaagcgcaacaacagtatctcagaggccaagacaagggagaaacacaagaaggaggtg
gaactgacagagattaatcggcggcacatcactgagtcagtaaactccatcagacggctg
gaagaggcccagaagcagcgccatgaacgcctggtggcagggcagcagcaagtcctccag
cagctagaggaagaggaacccaagctgctggcccagctgacccaggagtgtaaggaacag
cgagagagattgccccaggagatccgtcggtgcctgctgggcgagacatcagagggactg
ggggacggccccctggtggcctgtgccagcaatggtcatgcacctgggagtggtgggcac
ctgtccagcgctgactcggagagccaggaggagaacacccagctttga

DBGET integrated database retrieval system