KEGG   Mus pahari (shrew mouse): 110318082
Entry
110318082         CDS       T05929                                 

Gene name
Sufu
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110318082 (Sufu)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318082 (Sufu)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110318082 (Sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 110318082
NCBI-ProteinID: XP_021048484
Ensembl: MGP_PahariEiJ_G0014527
LinkDB
Position
1
AA seq 485 aa
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGADGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEEDSRSICLGTQPRR
LTGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAVIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcgtcgcccccggtcccgccgcgcccccggcctctggccct
agtgcccctccggcctttgcttcactctttcccccgggactgcacgccatctacggagag
tgtcgccgtctctaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggtccagaccccttggactatgttagcatgtacaggaacatggggagtcct
tctgccaacatccctgagcactggcactacatcagctttggcctgagtgatctttatggt
gacaacagagttcatgagtttacaggagcagacggaccaagtggatttggctttgagttg
acatttcgtctgaagagagaaactggagagtctgccccaccaacatggccagcagagctg
atgcagggcctagcccgatatgtcttccagtcagagaacaccttctgtagcggggaccac
gtgtcttggcacagccctctggataacagtgagtcaaggattcagcacatgctgctgacg
gaggatccacagatgcagcccgtgcggacaccctttggggtggtgactttcctccagatt
gttggtgtctgcactgaggagttacactcagcccaacagtggaacgggcagggcatcctg
gaactgctacggacagtgcccattgctggcggtccctggctgataactgacatgcggagg
ggagaaaccatatttgagatcgatccacacctgcaacaggagagagttgacaaaggcatc
gagacagacggttctaacctgagtggcgtcagtgccaagtgtgcctgggatgacctcagc
cggccaccagaggacgaggaggatagccggagcatctgcctcggcacacagcctcggagg
ctgactggcaaagacacagaacagatccgggagaccctgaggcgaggactggagattaac
agcaaacctgtccttccaccaatcaattctcagcgacagaacggcctcacccacgacagg
gctccgagccgcaaggacagcttgggcagcgacagctccacggccgtcatcccccacgag
ctgatccgcacacggcagcttgagagtgtgcatctaaaatttaaccaggagtctggagcc
ctcatccctctctgcctaaggggcagactcctgcatggccggcacttcacctacaagagt
atcacaggcgacatggccatcacgtttgtgtccacgggagtggaaggcgcctttgccact
gaggagcacccgtatgcagctcacggaccctggttacaaattctgttgacagaagagttt
gtagagaagatgttggaggacttagaagatctaacttctccagaggaatttaaacttccc
aaagagtacagctggcctgagaagaaactcaaagtgtccatcctccctgatgtggtcttc
gacagtccactgcactag

DBGET integrated database retrieval system