KEGG   Mus pahari (shrew mouse): 110318150
Entry
110318150         CDS       T05929                                 
Symbol
C8g
Name
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05146  Amoebiasis
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110318150 (C8g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110318150 (C8g)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110318150 (C8g)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110318150 (C8g)
  09164 Neurodegenerative disease
   05020 Prion disease
    110318150 (C8g)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 110318150
NCBI-ProteinID: XP_021048606
Ensembl: MGP_PahariEiJ_G0024737
LinkDB
Position
3:complement(12670098..12671831)
AA seq 202 aa
MLSPGAVLFFTLLLTASSLGQRTRKPSGSTSLISTIQPQANFNAQKFAGTWLLVAVGSSC
SFLQEQGHRAEATTLHTAPQDAAMAVSTFRKLDGICWQVRQLFGNTGVPGHFLSQVPRAR
GPVQMVVAETDYESFAILYLQQAKKLSVKLYVRSLPVSDSVLDVFEQRVRGANLTEDQIF
FFPKYGFCETADQLHILNEVPR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctgtccccaggggctgtgttgttcttcaccctgctcttgacagccagttcgctgggc
caaaggactcgaaagcctagtgggtctacctccctcatcagcactatccagccccaggcc
aatttcaatgctcagaagtttgcagggacatggctccttgtggctgtgggctcttcgtgc
agctttcttcaggagcagggacaccgagctgaggccaccacattgcacacagctccccag
gacgcagctatggctgtcagcaccttccgaaagctagatgggatatgttggcaggtacgc
caactctttgggaacacaggggtccctggccacttcttgtcccaagtcccacgggcccgt
ggaccagtgcagatggtggttgctgagaccgactatgagagctttgccatcctgtatctg
caacaggcaaagaagctgtctgtgaaactatacgtccgctcactgccagtgagtgactct
gtcctggatgtgtttgagcagcgagtcaggggagccaacctgacagaagaccagatcttt
ttctttcccaagtatggtttctgcgagactgcggaccaattacacatcctgaacgaggtg
ccgagataa

KEGG   Mus pahari (shrew mouse): 110323447
Entry
110323447         CDS       T05929                                 
Symbol
C8b
Name
(RefSeq) complement component C8 beta chain isoform X1
  KO
K03998  complement component 8 subunit beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05146  Amoebiasis
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323447 (C8b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323447 (C8b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110323447 (C8b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110323447 (C8b)
  09164 Neurodegenerative disease
   05020 Prion disease
    110323447 (C8b)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin Cyclophil_like
Other DBs
NCBI-GeneID: 110323447
NCBI-ProteinID: XP_021056323
Ensembl: MGP_PahariEiJ_G0028559
LinkDB
Position
6:55626616..55665332
AA seq 589 aa
MKIGAQVWRALAKSCLLCATLGCLHFPGSRGGKPDFFETKAVNGSLVKSRPVRSVADSPA
PIDCELSAWSSWTACDPCQKKRYRHTYLLRPSQFFGELCDLSDKEVEDCVTNQPCRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQQKMEQFWAIDRLASGINL
FTNTFEGPVLDHQYYAGGCSPHYILDTNFRKPYNVEGYTPQTKGEYEFTLTEYESYSEFE
HHVTKNTTNMFNFKFGFQVDGVIDLRIRAESNEGKNYISRTSRFSHTQNKFLHSRSVLEV
VHYKLKSRNLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGTYEYTLIMN
KDAMEQKEYNLNHVAACFGGGFNVGGIIYKVYVKVGVTVKICNDIMKEIKERNKKSSMVE
DLVVLVRGGTSEDITTLAYKELPTAELMKAWGDEVKYNPAIIKIKAEPLYELVTATDFAY
SSTVKQNLKKALEEFQREVSSCLCAPCRGNGVPVLKGSHCECICPGGFQGTACEVTHRKD
IPIDGKWSCWSDWSACSGGHKTRQRQCNNPAPQKGGSPCSGPASETLNC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaagataggggctcaggtttggagggcactggcaaagtcgtgtctcctctgtgctact
ctggggtgtctccatttccctggttccagaggtgggaagccagatttctttgagacaaag
gcagtcaatgggagccttgtcaagagcagaccagtacggagtgtggctgacagcccagca
cctattgactgtgagttatctgcctggtcatcctggactgcatgtgacccctgtcagaag
aaaaggtacagacacacttacttgctccggccctctcagttctttggggaattgtgtgac
ttgtccgacaaggaagttgaagactgtgttaccaaccaaccctgcagaagtcaagttcga
tgtgaaggctttgtgtgtgcacagacagggaggtgtgtgaatcgcagactcctctgcaat
ggggacaatgactgtggagaccaatcagatgaagccaactgtaggaggatttataaaaaa
tgccaacagaaaatggagcagttctgggcaattgacaggctggccagcgggataaatctg
ttcacgaacacttttgagggcccagttctcgatcaccagtattatgctggtggatgctcc
ccccactacatcctggacaccaactttaggaagccatacaacgtagaaggctacacccca
cagaccaaaggtgaatatgaattcacacttacagaatatgaatcgtattcagaatttgaa
catcatgtgacaaaaaatacaaccaacatgtttaatttcaagttcggttttcaagtggat
ggtgttattgatcttagaattagagcagaaagcaacgaaggcaaaaattacattagcaga
accagccgcttctcccacactcaaaacaagtttctccactcgcgctctgtccttgaagtg
gtgcattacaagctgaagtctagaaacctcatgctccattatgaattccttcagagggtc
aagagcctgcccttggagtatagctatggggaataccgagatcttcttcgtgactttggg
acccatttcatcactgaagccgtacttgggggcacttacgagtacacgcttatcatgaac
aaagatgccatggagcaaaaagagtataatcttaaccatgttgctgcctgttttggagga
ggtttcaatgtcggtggtatcatctataaagtctatgtcaaagtgggcgtgaccgtaaag
atatgcaatgacattatgaaagaaatcaaagaaagaaataagaaaagcagcatggtagaa
gacttggtagttcttgtgcgaggagggacaagcgaagatatcaccaccttggcatacaag
gagctgccaactgctgaactgatgaaggcatggggggatgaagtgaagtacaacccagca
atcatcaagatcaaggctgaacctctgtatgagcttgtgacagccacagactttgcatac
tccagcacagtgaagcagaacttaaagaaggcgctagaagaattccagagggaggtcagc
tcctgcctctgtgctccttgcagagggaatggagtccctgtcctgaaaggatcccactgt
gagtgcatctgtcctggtggcttccaaggcacggcctgtgaggttacccatcggaaagac
atccccatagatgggaagtggagttgctggtccgactggtctgcatgctctggaggacac
aaaacaagacaaaggcagtgtaataatccagcccctcaaaaaggaggcagcccctgttca
ggtcctgcttctgaaacactcaactgttaa

KEGG   Mus pahari (shrew mouse): 110323615
Entry
110323615         CDS       T05929                                 
Symbol
C8a
Name
(RefSeq) complement component C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05146  Amoebiasis
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323615 (C8a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323615 (C8a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110323615 (C8a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110323615 (C8a)
  09164 Neurodegenerative disease
   05020 Prion disease
    110323615 (C8a)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 110323615
NCBI-ProteinID: XP_021056596
Ensembl: MGP_PahariEiJ_G0028560
LinkDB
Position
6:complement(55680586..55731931)
AA seq 587 aa
MFAVAFFGLSLVAWHPGITAQEKVNQRVTRAVTPKAESCRLSDWYKWTDCFPCQDKKYRY
RSLLQPSKFGGTICSGDIWAEASCDSPTPCLRQARCGQDFQCGETGRCLKRHLVCNGDND
CLDGSDEEDCEDVRVTEDDCRQYEPIPGSERAALGYNILTQEEAQSVYDAKYYGGRCETV
YNGDWRKLQYDPTCERLYYGDDEKYFRKPYNFLKYHFEALADTLFSSEFYDDANELFLNI
KNAKFHSGGVTVGVAPIKSPVSVDVSGSGSKASSFLRKLDKYNEKRYGFMRVSTKVQTAH
FKMRRSNIVLDEGMLQSLMELPEQFNYGMYAKFINDYGTHYITSGTMGGIYEYVMVLDKE
KMKVEGITVDDIKTCVGGGIGLGFKDKLIGGASISGEFCGDSGDAARETQKKISGVEDII
SRVQGGSSVGGGVLTHNISAITYQSWGRSLKYNPAVIDFEIQPIYQLLRHTNLGPLETKR
QNLRRALDQYLMEFNACRCGPCFNKGEPILDRTSCRCQCSKGRQGLACEHAALDGIEDIK
APGRWSCWSSWSECRGGSQERRRQCNNPPPQNGGAPCLGRNLQTQAC
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtttgcagttgctttctttggcttgtctttggtggcatggcaccctggcataactgca
caagagaaggtgaaccagagggtaacccgagctgtgaccccgaaagcagagtcctgtcgg
ttgagtgactggtacaaatggacagattgttttccatgtcaggataaaaagtaccgatac
cggagcctcttgcagccaagcaagtttggaggaaccatctgcagtggtgatatctgggcc
gaggccagctgtgacagccccacaccttgtctaaggcaggcacggtgtggacaggatttc
cagtgtggagagacaggtcgctgcctgaaacgccacctggtgtgtaacggagataacgac
tgcctcgatggctctgatgaggaagactgtgaggatgtcagggtcactgaggatgactgc
cgccagtatgaaccaatcccaggatctgaaagggcagccttggggtacaacatcctgact
caagaagaagcccagagtgtttacgatgctaagtattatgggggccggtgtgaaactgtg
tacaatggagactggagaaaactgcagtacgaccccacctgtgagcgcctctactatgga
gatgacgagaaatactttcggaagccctacaacttccttaagtaccactttgaagccctg
gcggatactttattctcctcagagttttatgacgatgcaaatgaactctttttaaacata
aagaatgccaagttccactcaggtggcgtaactgttggcgtagccccaataaaaagtcct
gtctcagtagacgtgtctggatccggatccaaagcatcctcattcctgagaaagttagac
aagtataatgagaagagatacggcttcatgagagtgtctacaaaggtacagactgcacat
tttaagatgagaaggagcaatattgtgctggatgaaggaatgctgcagtcattaatggag
ctcccggagcagttcaactatggcatgtatgccaagttcatcaatgactatggcacccac
tacatcacctctggaaccatgggtggcatttatgaatatgttatggtgcttgacaaagag
aaaatgaaagttgaaggtattaccgtggatgacatcaaaacatgtgttggtggtggcatt
ggcttaggatttaaggataaactaattggaggagcaagtatatcaggagagttttgtgga
gactctggagatgccgcccgtgaaacacagaagaaaatctcgggagtggaggacatcatt
tctcgggtgcaaggcggaagttctgtcgggggcggtgtcttgacacacaacatcagtgcc
attacatatcagtcctgggggagatcattaaagtataaccctgctgttatcgattttgag
atacagcctatctaccaactactgcggcacacaaacctgggacctctggagacaaaacgt
cagaacctgcgccgggctttggaccagtacctgatggaatttaatgcctgtcgctgtggg
ccctgcttcaacaaaggggagcccattctcgaccgcaccagctgccggtgtcagtgtagt
aagggccggcagggcctggcctgtgaacacgcggcgctagacgggatcgaagacatcaaa
gcccctgggcgctggagctgctggagttcctggtcagagtgcagaggaggttcccaggag
aggaggagacagtgcaacaacccaccaccccagaatggaggtgccccatgcctagggagg
aacctgcagacccaggcctgctga

KEGG   Mus pahari (shrew mouse): 110328891
Entry
110328891         CDS       T05929                                 
Symbol
C7
Name
(RefSeq) complement component C7
  KO
K03996  complement component 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110328891 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110328891 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110328891 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    110328891 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi TSP1_spondin TSP_1 Ldl_recept_a
Other DBs
NCBI-GeneID: 110328891
NCBI-ProteinID: XP_021064037
Ensembl: MGP_PahariEiJ_G0016014
LinkDB
Position
11:complement(51992208..52053126)
AA seq 846 aa
MQVTSLLILVGFIAEFQVFSSASSPVNCKWDSFGPWSECNGCTKTQTRRRSVAVYGQYGG
HPCVGSAFETQSCKPELGCPTEEGCGDRFRCFSGQCISKLLVCNGDSDCEEDGADEDRCE
IEGSRPSCDIDKPPPNIELTGCGYDAVTGQCKRRVINTKSFGGQCRKVFSGDGRDFYRLS
GNILSYTFQVKIHNDFNYEFYNSSWSYIKHTSTEGNSFYSRKGFLSRSSNQQTHGSETEK
IDMTTKSYTLLVVKNTVEVAQFINNNPEFLQLAEPFWKELSHLPTLYDYSAYRRLIDQYG
THYLQSGSLGGDYRVLFYVDSGGSQKSDAQSKRDNTCSSEDFKFLFISSSSRRCEKLLED
AKSSSGNNGRVLRGKPLVRGGDSGFVADLNFLDLDNPAGNRQRYSSWAGSVTRLPTIIKE
KLAPLYELVKEVPCASVKRLYLKRALEEYFDEFDPCHCQPCQNGGLAIVLGTQCQCHCKP
YTFGSACEQGVLVGDQAGGVDGGWNCWSSWSPCVQGKRTRSRKCNNPPPRDGGKSCLGET
TESKQCEDQDLENLRLLEPHCFSSSLAPKGFCPPPPALKDGFVQGEGTMVPVGQSIVYAC
DEGYSLTGDPVARCGEDLQWLVGEMHCRKMACVLPGEMNGMQSHPQKPFYMVGEKVTLSC
VGGMSLEGPSTFLCGSSLKWSPELKDAQCVQKATRTPPPAAPECQPWEKLQNSKCVCKMP
YECGSSLDVCARDESRNKILPLTVCKMHVVHCNKRNYTLVGKDSCTLPSLAEKVCGACPI
WTKCDAQNGKCVCREASECQVAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIKPC
SEEEAP
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgcaggtgacaagcttattaattttggtgggatttatagcagagtttcaagtcttctct
agcgcctcctctccagtcaactgcaagtgggactccttcggcccttggtcagaatgcaat
ggctgtaccaagactcagactcgaaggcgttcagttgctgtttatgggcaatatggaggc
catccatgtgtggggagtgcttttgaaacacaatcctgcaaacctgaactgggctgtccg
acggaagagggctgtggggaccggtttagatgtttttcaggtcagtgcatcagcaagtta
ttggtttgcaatggggattctgactgtgaggaagacggtgctgatgaagacagatgtgag
attgagggtagcagaccttcgtgcgacattgataaacctcctcccaacatagaactcacc
ggttgtggttacgatgcagttactggccagtgtaagagaagagtcatcaacaccaaaagt
ttcggtggtcagtgcaggaaagtgttcagcggggacggaagagatttctacagactaagt
ggaaatatcctctcttatacattccaggtgaaaatacataatgattttaactatgaattt
tacaacagcagttggtcttacataaagcacacatccacagagggaaattcattttattca
cggaagggctttctttcccgctcatcgaatcaacaaactcacggttcagaaacagagaaa
atcgacatgacaacgaagagttatacattgttggttgttaagaacactgtggaagtggcc
cagttcattaataataatcctgaatttttacaacttgctgagccattctggaaggaactc
tcccatcttcccactctgtatgactacagtgcctaccgacggttaatcgatcagtatggg
acacattacctgcagtccgggtctttaggaggagactatagagttctattttatgtggat
tcaggaggttcccaaaaaagtgatgctcagtcaaagagggataatacatgttcgtctgaa
gactttaagtttctttttatatcatcatcatcacgcagatgtgagaaactgctagaggat
gccaagtcaagttcaggaaataacggcagggtgcttcgaggaaagccattggtcagaggt
ggagattctggctttgtagctgaccttaatttcctggacctggataatcctgctggaaac
agacagcgatattcctcctgggccgggtctgtaaccagacttcccacaatcataaaagaa
aagctggcgccgttgtatgagctggtcaaggaggtgccctgtgcctctgtgaaaaggctg
tacctgaagcgggcccttgaggagtacttcgacgaatttgacccctgccattgccagcct
tgccagaatggcggcctcgctattgttctggggacacagtgccagtgtcactgcaaacca
tacacatttggttcggcgtgtgagcaaggagtccttgtcggcgatcaagcaggaggggtt
gacggaggttggaactgttggtcctcttggagcccctgtgttcaagggaagagaacaagg
agccggaaatgcaataatccccctcccagagacggtggaaagtcctgtcttggagaaaca
actgagagtaagcagtgtgaagaccaggacttggagaacttgcgattacttgagccacat
tgctttagttcgtctttggctccaaaaggattctgcccaccaccccctgccttaaaagat
ggatttgttcaaggtgaaggtaccatggttcctgttgggcaaagcatagtatatgcctgt
gatgaagggtattctcttacgggagatcccgttgccagatgtggagaagacttacagtgg
cttgttggagaaatgcattgtcgaaaaatggcctgtgttctacctggagagatgaatggc
atgcagagtcacccccagaaacctttttacatggttggggagaaggtgactctttcctgt
gtggggggtatgtccttagaaggcccttcaaccttcctctgtggctccagcctgaagtgg
agtcctgagttgaaggatgctcagtgtgtgcaaaaagctacccgcactccaccaccagca
gcccctgaatgtcagccctgggagaaactgcagaactcaaaatgcgtctgtaaaatgccc
tatgaatgcggatcctccttggacgtatgtgcccgagatgagagtagaaacaagattctg
cctctgaccgtctgcaagatgcacgttgtccactgtaataaaagaaattacactcttgtt
ggcaaggacagctgtactctgccttccctggctgagaaagtctgtggtgcatgcccaata
tggaccaaatgtgatgctcagaacggcaaatgtgtctgcagagaagcatccgagtgccag
gtagcaggctacagaatctgtgtggaagtgaatggcaaagaggagacgatgtctgagtgt
gaggctggcatcttaagatgcagaggacagagcatctccatcacagctataaagccctgt
tctgaagaagaagctccgtag

KEGG   Mus pahari (shrew mouse): 110329162
Entry
110329162         CDS       T05929                                 
Symbol
C9
Name
(RefSeq) complement component C9
  KO
K04000  complement component 9
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05146  Amoebiasis
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110329162 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110329162 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110329162 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110329162 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    110329162 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 110329162
NCBI-ProteinID: XP_021064428
Ensembl: MGP_PahariEiJ_G0016021
LinkDB
Position
11:53236304..53291831
AA seq 561 aa
MLCKTPGLPRRSGDASGMAITLALAIFALSVNAQSPIPNLREEQGQHSPLPIDCKMSPWS
EWSECDPCLKQRFRSRSILAFGQFKGKSCIDALGDRQLCEPTQECEEIQENCGNDFKCET
GRCIKRRLLCNGDNDCGDFSDEDDCDSEPRTPCRNRVVEESELGLTAGYGINILGMDPLS
TPFDNEFYNGLCERIRDEKTHYRRPWNVASLIYETKADKNFRTENYEENMEVFKAVSRES
TFGLSANLALKFSATEAPGKRIGDISPGEQSSKPTDTEAKFKLSYYMGKSFQQLSSYFSQ
TKKIFVHLRGTVQLGRFVMRNRDVMLRSTFLDDIKALPPSYEKGEYFGFLETYGTHYSTS
GSLGGKYEMIYVLDKASMKEKGVELNDVKHCLGLDLDVHIPLQGNLKDASVTASVNGSGC
IKTTGGKTVNITHDNIIDDVISFVRGGSREQAVLLKEKILRGDKTVDKTDFANWASSLAD
APALISQKLSPIYNLIPVKIKDAYIKKQNLEKAIEDYIDEFNAKKCYPCQNGGTAFLLDG
QCMCSCPVTFEGDACEIHQKL
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgctttgcaagactccagggctccccaggaggagcggcgatgcctcaggcatggccatc
accttagcccttgcaatctttgccttgagtgtcaatgcacagagcccgatacccaatctc
agagaagaacaaggacaacactctcccctaccgatagactgcaaaatgagcccatggagc
gaatggtcagagtgtgatccttgcctcaaacaaaggtttcgctcaagaagcattttagcc
ttcggacagtttaaagggaaaagctgtattgatgctttgggagacagacaactctgtgaa
cccacccaagagtgtgaagagatacaggaaaactgtgggaatgactttaagtgtgagaca
ggcaggtgcataaagaggagacttctgtgtaatggtgacaatgactgtggagatttttct
gatgaggatgactgtgacagtgaaccccgcaccccatgccgtaaccgagtagtggaagaa
tcagaactgggactaacagcaggctatgggatcaacatcttagggatggatcccctgagt
acaccttttgacaatgagttctacaatggactctgtgagcggatacgggacgaaaagaca
cactatcgcagaccttggaatgtagcttctctgatctatgaaaccaaggctgataaaaat
ttcagaactgagaactatgaagaaaacatggaagtattcaaagctgtcagccgagagagc
acctttggtcttagtgcaaatttagccctaaaattttcagccactgaagcacctggaaag
agaattggggacatctccccaggagaacagtcttcgaaacctacagacactgaagctaaa
tttaaattgtcatattacatggggaaaagttttcaacaactatcatcttatttttcgcag
acgaaaaagatctttgtgcacttgagaggaaccgttcaactggggagatttgtaatgagg
aatcgggatgttatgctgagatcaactttcctggatgatataaaagctctaccaccttcc
tatgaaaagggagaatattttggatttttggaaacctatgggactcactacagtacctct
gggtccctgggaggaaaatatgaaatgatctatgtcttggataaagcttccatgaaagag
aaaggtgttgaactgaatgacgtaaaacactgtcttgggttggatctggatgtacatatt
cctctacaaggcaacttaaaggatgcatcagtcacagcaagtgttaatgggagtggttgc
ataaagacaactggtgggaaaactgtaaacatcacccacgataacatcatagatgatgtt
atttcattcgtaagaggagggtctagagagcaagcagttctcctgaaagagaagattctc
agaggagacaagacagttgataagactgacttcgctaactgggcctcatctctggcggac
gctccagctctcattagtcaaaaactgtcccctatatataatctcattcctgtgaaaata
aaagatgcatacataaagaagcaaaatttggaaaaggctattgaagactatatagatgaa
ttcaatgctaaaaagtgctacccatgtcaaaacggaggtactgcatttcttctggatgga
cagtgcatgtgttcctgcccagtgacatttgagggagatgcctgtgaaatccatcaaaaa
ctatag

KEGG   Mus pahari (shrew mouse): 110329165
Entry
110329165         CDS       T05929                                 
Symbol
C6
Name
(RefSeq) complement component C6
  KO
K03995  complement component 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05020  Prion disease
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110329165 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110329165 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110329165 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    110329165 (C6)
SSDB
Motif
Pfam: MACPF Sushi Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 110329165
NCBI-ProteinID: XP_021064430
LinkDB
Position
11:51788962..51862488
AA seq 933 aa
MARHLTLCFILLVILIDKSEACFCDHYPWTHWSSCSKSCNSGTQSRQRQIVVDGYYWENG
CDELCTKRETRQCNMQTCPINCALGDYGTWSDCDPCTEKQVKVKSVLRPSQFGGQPCTEP
LVTFQPCVPSKLCKIEETDCKNKFLCDSGRCIPNKLQCNGENDCGDNSDERNCGSTKKVC
TRIYIPIPSVQLMGTGFHFWSGEPRGEVLDNSFTGGICKLVKSSRASNPYRVAANLENVN
FEVQTIEDDLKTEFYKDLTSFENKKETTDSFSGMTDSSYRGFFYSSEERRSFKYSSAFQK
VIKASHKKDSSFIRIHKLIKVLNFTMKATDLQLSDVFLKSLVHLPLDYNSAVYGQIFDDF
GTHYFTSGSLGGKYDLFYQFSRQELQNSGLTKEEAQNCVLYETKKRYVFVKKTHKEEKCT
TNKLSEKYEGSFLQGSEKSISLVLGGRSQEAAALAWEKGTSGPEEKVYSEWLESVKENPA
VVDYELAPITDLVRNIPCAVTKRNNLRRALLEYAAKFDSCQCAPCPNNARARLSGTECLC
VCQSGTYGENCEHRSPDYKSDAVDGNWGCWSSWSACNAAYRRSRTRECNNPAPQRGGKSC
DGMNKQEEDCTFSIMENVGQPCINDDEEMKEVDLAGSESDSGCPQPPLPENAFIWNEKKV
YSVGEDVEISCLTGFTAVGFQYFRCLPDRTWRQGDVECQRTACLKPVVQDVLTVSPFKRV
YQIGESIELKCPRGFVVAGPSRYTCKEDSWTPPISSSLTCEQDILTKPKGLCPLGQKQSG
SECICMSPEEDCSGYSEDLCIFDEGSSQYFTSSACKFLAGKCLSNSQSHFVHSGSCQEGP
QLEWGLERLKLAANSTKRVPCGYNTCYDWENCSAHTSNCVCLLPPRCSKDENQLYCAKIG
SSMLRKTVNLCVMGAVRCANIKVEILNPGRCPD
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggccaggcatctcacgttgtgtttcattttgctggtcatactgattgacaagagtgaa
gcctgtttctgtgaccactacccatggactcactggtccagctgttctaagtcctgcaat
tctggaacccagagcagacagagacaaatagtagtggatggttactattgggaaaatgga
tgtgatgagctttgtaccaagcgggagaccagacagtgcaacatgcagacatgtcccatc
aactgtgccctaggagactatgggacatggtcagactgtgacccttgtactgaaaaacag
gttaaagttaaatctgtcctgcgcccaagtcagtttggggggcaaccatgcacagagccc
ctggtgacctttcaaccgtgtgtcccctccaagctctgcaaaattgaagagactgactgc
aagaataaattcctctgtgacagtgggcgctgtattcccaacaagttacaatgcaatgga
gagaatgactgtggagacaattcagacgaaaggaactgtgggagcacaaagaaagtgtgc
acacggatatacattcccatccctagcgtgcagctgatgggcactgggtttcatttctgg
tcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaactc
gtcaagagcagtcgagccagtaatccataccgtgttgcagccaatctggaaaatgtcaac
tttgaggtacaaactatagaagatgacttgaaaacagaattctacaaggatttaacctct
tttgaaaataaaaaggaaaccactgattcattcagtggtatgacagattcttcctataga
ggatttttctattcctcagaggaacgtagaagtttcaaatatagctctgccttccaaaaa
gtcattaaagcctcccacaagaaggattctagctttatcaggatccataaactgataaaa
gtcttaaacttcacaatgaaagcgacagacctgcagctttcagatgtcttcctgaaatcc
cttgtccacctgcctttagactacaactctgctgtgtacggccagatatttgatgacttc
gggacccactacttcacctcgggctccctggggggcaagtatgaccttttctaccaattc
agccgccaggagctacagaactcaggtttaacaaaagaagaagctcaaaactgtgtcctc
tatgaaacaaagaaacggtatgtctttgttaaaaaaacacacaaggaagaaaagtgcact
acaaacaagctgtctgaaaaatacgaaggttcctttttgcagggatcagagaaatccatt
tccctggtcctgggcgggaggagtcaggaggcagcagccttggcatgggagaagggcacc
tctggtccagaggagaaggtctactctgagtggttagaatcggtgaaggaaaaccctgct
gtggttgattatgagcttgccccgatcacagacttggtcagaaacatcccgtgtgcagtg
acaaaacggaacaacctcaggagagcgcttctagagtatgcagccaagtttgactcttgc
cagtgtgcgccatgtcccaataacgcccgcgccaggctctcaggcaccgaatgcctgtgt
gtgtgccagagcggcacctacggtgagaactgcgagcacaggtccccggattacaaatct
gatgcagtagatggaaattggggctgctggtcttcctggagtgcatgcaatgctgcttat
aggagatcaagaacccgagagtgtaataaccctgcgccacagcgaggaggaaaaagctgt
gatggcatgaataagcaagaagaagactgtacattctcaataatggaaaatgttggacaa
ccatgtatcaatgatgatgaagaaatgaaagaggtagaccttgctgggtcagaatcagat
tcagggtgtcctcaaccacctctcccggaaaatgcatttatctggaatgagaagaaagtg
tactcagttggggaggatgttgaaatttcatgtcttactggcttcacagctgttggattc
cagtacttcagatgtttaccagacagaacctggaggcaaggagacgtggaatgccaacgg
actgcgtgcctcaagcccgttgttcaggatgtcctgaccgtctccccctttaagagagtg
tatcagattggggaatccattgagctgaaatgccccagaggttttgttgttgctggacca
tcaaggtatacatgcaaggaagactcctggacacctcccatttcaagttcattgacctgt
gagcaagatattctgacaaagccaaagggcctttgtccactgggacaaaaacaatctgga
tccgagtgtatttgtatgtccccagaagaagactgtagcggttattcagaagatctctgt
atatttgatgagggatccagccagtacttcacttcatccgcttgcaaatttttggctgga
aaatgtttaagcaacagccagtcccactttgtccattctggttcctgccaagaaggccca
cagttagaatggggccttgagaggctaaaactcgcagcgaatagcacaaagagagtgccc
tgtggatacaacacctgctatgactgggaaaattgttcagcccacacttccaactgtgtc
tgcctgttgcccccacggtgctccaaggatgaaaaccaactctactgtgccaaaataggg
tcatcgatgcttaggaaaacagtaaacctctgtgtgatgggagctgtgaggtgtgcaaac
ataaaggtggaaatactgaatcctgggaggtgcccggattag

DBGET integrated database retrieval system