KEGG   Mus pahari (shrew mouse): 110318357
Entry
110318357         CDS       T05929                                 

Gene name
Rorb
Definition
(RefSeq) nuclear receptor ROR-beta isoform X1
  KO
K08533  RAR-related orphan receptor beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110318357 (Rorb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110318357 (Rorb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110318357 (Rorb)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110318357 (Rorb)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   110318357 (Rorb)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110318357
NCBI-ProteinID: XP_021049008
Ensembl: MGP_PahariEiJ_G0014302
LinkDB
Position
1
AA seq 470 aa
MCENQLKTKADCTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNTETGGTYANGHVIDLPKSEGYYSIDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMSEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCAAVCK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtgtgagaaccagctcaaaactaaagctgactgcactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataaatcctccgggatccactacggagtcatcacgtgtgaaggc
tgcaagggattcttcaggaggagccagcagaacaatgcctcttactcctgcccaaggcag
agaaactgtttaattgacagaaccaacaggaaccgttgccaacactgccgcctgcagaag
tgtcttgccctaggaatgtcaagagatgctgtaaagttcgggaggatgtccaagaagcag
cgagacagcctgtatgctgaggtgcagaagcatcagcaaaggctgcaggagcagcggcag
cagcagagtggggaggcggaggccctcgccagggtgtacagcagcagcattagcaatggc
ctcagcaacctgaacaccgagaccggcggcacatacgctaatgggcacgtcattgacctg
cccaagtccgaaggttattacagcatagattccggtcaaccgtctcccgatcagtcagga
ctggacatgactggaatcaaacagataaagcaagaacctatctatgacctcacatccgtt
cccaacttgtttacctatagctctttcaacaacgggcagttagctcccgggataacaatg
tctgaaatcgatcgaattgcacagaacatcattaagtcccatttggagacatgtcagtac
acaatggaagagctccatcagctggcatggcagacccacacctacgaggaaatcaaggcg
tatcaaagcaagtccagggaggctctgtggcagcagtgtgctatccagatcacccatgcc
atccagtacgtggtagagttcgccaagcggataacaggcttcatggagctgtgtcagaac
gatcagatcttacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgtcgt
gccttcaacccattaaacaacacagttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaagccttaggttcggatgacctagtgaatgaagcgtttgactttgcgaagaatctg
tgttccttgcagctgactgaggaggagatcgctctcttctcctctgctgttctgatatcc
ccagaccgagcctggctgatcgaaccaagaaaagtccagaagcttcaggaaaaaatttat
tttgcacttcaacatgtgattcagaagaatcacctggatgatgagaccctggcaaagtta
atagccaagataccaacgatcacggcagtctgcaacttgcatggggagaagctgcaggta
tttaagcagtctcatccagacattgtgaatacactgtttcctccattgtacaaggagctc
tttaatcctgactgtgctgcggtctgcaaatga

KEGG   Mus pahari (shrew mouse): 110320015
Entry
110320015         CDS       T05929                                 

Gene name
Rorc
Definition
(RefSeq) nuclear receptor ROR-gamma isoform X1
  KO
K08534  RAR-related orphan receptor gamma
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04659  Th17 cell differentiation
mpah04710  Circadian rhythm
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110320015 (Rorc)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110320015 (Rorc)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    110320015 (Rorc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110320015 (Rorc)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110320015 (Rorc)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110320015 (Rorc)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   110320015 (Rorc)
SSDB
Motif
Pfam: zf-C4 Hormone_recep DDE_Tnp_1_7
Other DBs
NCBI-GeneID: 110320015
NCBI-ProteinID: XP_021051497
Ensembl: MGP_PahariEiJ_G0026751
LinkDB
Position
4
AA seq 516 aa
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQREQVAKTPPAGSHGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDSQLTLARCGLRFEESRHPELG
EPEQGPDSHCRPSFCSAPEAPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRNNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLKAGAMEVVL
VRMCRAYNASNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTA
LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLVKLPPKGKLRSLCSQHVEK
LQIFQHLHPIVVQAAFPPLYKELFSTDIESPEGLSK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacaccaccggacatctcgggagctgctggctgcaaagaag
acccacacctcacaaattgaagtaatcccttgcaagatctgtggggacaagtcatcgggg
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccgcagccagcag
tgtaatgtggcctactcctgcacacgtcagcagaactgccccattgaccgaaccagccgc
aaccgatgccagcattgccgcctgcagaagtgcctggctctgggcatgtcccgagatgct
gtcaagtttggccgaatgtccaagaagcagagggacagtctacatgcagaagtgcagaaa
caactgcaacagcagcagcaacgggaacaagtggccaagactcctccagctgggagccat
ggagcagacacacttacgtacactttagggctctcagatgggcagctacctctgggcgcc
tcacctgatctacccgaggcctctgcttgtccccctggcctcctaagagcctcaggctct
gggccgccatattccaataccttggccaaaacagaggttcagggggcctcctgccacctt
gagtatagtccagaacgaggcaaagctgaaggcagagacagcatctacagcactgacagc
cagcttactcttgcaagatgtggacttcgttttgaggaatccaggcatcctgagcttggg
gaaccagaacagggtccagacagccactgccgtcccagtttctgcagtgccccagaggca
ccatatgcctctctaacagacatagagtacctggtacagaatgtctgcaagtccttccga
gagacatgccagctgcgactggaggaccttctacggcaacgcaacaacctcttctcacgg
gaggaggtgaccagctaccagaggaagtcaatgtgggagatgtgggagcgctgtgcccac
cacctcactgaggccattcagtatgtggtggagtttgccaagcggctttcaggcttcatg
gagctctgccagaatgaccagatcatactactgaaagcaggagcaatggaagtcgtccta
gtcagaatgtgcagggcctataatgccagcaaccacacagtcttttttgaaggcaaatac
ggtggtgtggagctgtttcgagccttgggctgcagcgagctcatcagctccatattcgac
ttttcccacttcctcagcgccttgtgtttttctgaggatgagattgccctctacacggcc
ctggtgctcatcaatgccaaccgtcctgggctccaagagaagaggagagtggagcatctg
caatacaatttggagctggccttccatcatcatctctgcaagactcatcgacaaggcctc
ctagtcaagctgccacccaaagggaaactccggagcctgtgcagccaacatgtggaaaag
ctgcagatcttccagcacctccaccccatcgtggtccaagctgccttcccgccactctat
aaggagctcttcagcactgacattgagtcccccgaggggctgtcaaagtga

KEGG   Mus pahari (shrew mouse): 110327499
Entry
110327499         CDS       T05929                                 

Gene name
Rora
Definition
(RefSeq) nuclear receptor ROR-alpha isoform X1
  KO
K08532  RAR-related orphan receptor alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04659  Th17 cell differentiation
mpah04710  Circadian rhythm
mpah05017  Spinocerebellar ataxia
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110327499 (Rora)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110327499 (Rora)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    110327499 (Rora)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110327499 (Rora)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110327499 (Rora)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110327499 (Rora)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110327499 (Rora)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   110327499 (Rora)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110327499
NCBI-ProteinID: XP_021062212
Ensembl: MGP_PahariEiJ_G0015257
LinkDB
Position
10
AA seq 523 aa
MESAPAAPDPSASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSYASSSRGVSVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNITKSHLETCQYLREELQQITW
QTFLQEETENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgacccctccgccagcgagccgggcagcagcggctcg
gaggcggccgccggctccagggagaccccgctgacccaggacacgggccgcaagagcgag
gcaccgggcgcggggcgcaggcagagctatgcgagctccagccgaggtgtctcagtcacg
aagaagacacacacatctcaaattgaaattattccatgcaagatctgtggagacaaatcg
tcaggaatccattatggtgtcattacgtgtgagggctgcaagggctttttcaggagaagt
cagcagagcaatgccacctactcctgtccccggcagaagaactgtttgatcgatcggacc
agcagaaaccgctgccagcattgtcggctgcagaaatgcctggccgtggggatgtctcga
gatgctgtcaagtttggccggatgtccaagaagcaaagagacagcttgtacgccgaggtg
cagaagcaccggatgcagcagcagcagcgagaccaccagcagcagcctggggaggccgag
ccgctgacgcccacctacaacatctcagccaatgggctgacggaactgcacgatgacctc
agcacctacatggacgggcacaccccggagggcagcaaggccgactcagccgtcagcagc
ttctacctggacatccagccctccccagaccagtcgggattggacatcaatgggatcaaa
cccgaacccatatgtgactacacaccagcatctggcttcttcccctactgctccttcacc
aacggagagacttccccaaccgtgtccatggcagaactagaacaccttgcacagaacata
accaaatcccacctggaaacctgccagtacttgcgggaagagctccagcagataacgtgg
cagaccttcctgcaggaggagactgagaactaccagaacaagcagagagaggtgatgtgg
cagctgtgtgccatcaagattacagaagctatccagtatgtggtggagtttgccaaacgc
attgatggatttatggagctgtgtcaaaatgatcaaattgtgcttctaaaagcaggctct
ctagaggtggtgttcattaggatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgatgggaagtatgctagccccgatgtcttcaaatccctaggttgtgaagacttcatt
agctttgtgtttgaatttgggaagagtttgtgttctatgcacctgaccgaagacgaaatc
gcattattttctgcatttgtactgatgtcagcggatcgctcgtggcttcaggaaaaggta
aaaatagaaaagctgcaacagaaaattcagctagcccttcagcatgtcctacagaagaac
caccgagaagatggaattctaacaaagctaatatgcaaggtgtctacgttaagagcccta
tgtggacgacatacggaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccattatacaaggaattgttcacttcagaatttgagccagcaatgcaa
atcgatgggtaa

DBGET integrated database retrieval system